KEGG   Staphylococcus schleiferi 1360-13: LH95_02170Help
Entry
LH95_02170        CDS       T04012                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ssch  Staphylococcus schleiferi 1360-13
Pathway
ssch00010  Glycolysis / Gluconeogenesis
ssch00053  Ascorbate and aldarate metabolism
ssch00071  Fatty acid degradation
ssch00280  Valine, leucine and isoleucine degradation
ssch00310  Lysine degradation
ssch00330  Arginine and proline metabolism
ssch00340  Histidine metabolism
ssch00380  Tryptophan metabolism
ssch00410  beta-Alanine metabolism
ssch00561  Glycerolipid metabolism
ssch00620  Pyruvate metabolism
ssch00625  Chloroalkane and chloroalkene degradation
ssch01100  Metabolic pathways
ssch01110  Biosynthesis of secondary metabolites
ssch01120  Microbial metabolism in diverse environments
ssch01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ssch00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    LH95_02170
   00053 Ascorbate and aldarate metabolism
    LH95_02170
   00620 Pyruvate metabolism
    LH95_02170
  Lipid metabolism
   00071 Fatty acid degradation
    LH95_02170
   00561 Glycerolipid metabolism
    LH95_02170
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    LH95_02170
   00310 Lysine degradation
    LH95_02170
   00330 Arginine and proline metabolism
    LH95_02170
   00340 Histidine metabolism
    LH95_02170
   00380 Tryptophan metabolism
    LH95_02170
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    LH95_02170
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    LH95_02170
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    LH95_02170
Enzymes [BR:ssch01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     LH95_02170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF2229
Motif
Other DBs
NCBI-ProteinID: AKS66342
LinkDB All DBs
Position
complement(520963..522450)
Genome map
AA seq 495 aa AA seqDB search
MGINVKDYVSDQYELFIGGEFVKPESGEYLDVSNPATGEVLAKVAKANEQDVNKAVKAAQ
DAFPEWSRKSKQERSNLLRQIHDKLMEKKDHFATIETLNTGKAIRESSNIDIPAAARHYQ
YFASVVDTDEGSLNNIEDNVMSIIQHEPIGVVGAVVAWNFPMLLASWKLGPALAAGNTVV
IQPSSSTPLSLIELAKIFQEVLPAGVVNVVTGKGSESGNAIFNHEGVDKLSFTGSTDVGY
QVAEAGAKRIVPATLELGGKSANIILDDANLDLALEGIQLGILFNQGEVCSAGSRLLVHE
KIYDTLVPRLVEAFKQIRVGDPLDSTTQMGSQTGQAQIDKIQGYIDYAKENDANILVGGH
RLTDNGLDKGHFFEPTLIEVKDNKNKLAQEEIFGPVLTIIKVKDDEEAIQIANDSEYGLA
GGVFSTNINRALNVAKNVRTGRVWVNTYNQVPEGAPFGGYKKSGIGRETYKDAIANYQQV
KNIYIDISNETKGLY
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgggtatcaatgttaaggattatgtttctgatcaatatgaactgtttattggcggagaa
tttgtaaagccggaatctggtgagtacttagatgtgagcaatccagcaacaggcgaagtt
ttagcaaaagtcgctaaagccaatgaacaagacgtcaataaagctgttaaagcagcgcaa
gatgcatttccagaatggagccgcaaatcaaaacaagaacgttcaaatttattacgtcaa
atccatgataaattaatggagaaaaaagatcactttgcaacaattgaaacgttaaacaca
ggtaaagctatacgtgagtcttcaaatatcgatatccctgctgcagcacgtcattaccaa
tattttgcaagtgtagtggatacggatgaaggatctctcaacaatattgaagacaatgtt
atgagcattattcaacacgaaccaattggtgttgttggtgctgttgttgcatggaacttc
ccaatgctacttgcttcatggaaattaggtccagctttagctgcaggtaacacagtcgtt
atccaaccttcttcttcaacaccgttaagtttaattgaattagctaaaatcttccaagaa
gttttaccagcaggtgttgtcaatgtcgtaacaggtaaaggttcagaatctggtaatgcc
attttcaatcatgaaggtgtcgacaaattatcattcactggttctactgatgtgggttat
caagttgcagaagcaggtgcaaaacgtatcgtaccagcaacacttgaacttggtggtaaa
agtgccaatattattttagatgatgcaaacctagatttagctttagaaggcatccaactc
ggtatcttattcaaccaaggtgaagtatgtagtgcaggttctcgtttacttgttcatgaa
aaaatttatgacacacttgtaccacgacttgttgaagcatttaaacaaattagagttggc
gatccacttgatagcactacacaaatgggttctcaaactggccaagcacaaatcgataaa
attcaaggttatatcgactatgcgaaagaaaacgatgccaatattctcgtcggcggtcac
cgtttaactgataacggattagataaagggcatttctttgaacctacgcttatcgaagta
aaagataataaaaataaactagctcaagaagaaatctttggtcctgtattaacaattatt
aaagtgaaagacgatgaagaagcaattcaaattgcaaatgactctgaatacggcttagct
ggtggtgttttctcaacaaatattaaccgtgcattaaatgtagcaaaaaatgtccgtaca
ggtcgtgtatgggtcaacacgtataaccaagtccctgaaggcgcaccattcggaggctac
aaaaaatcaggtattggtcgtgaaacttataaagatgccattgcaaactaccaacaagtt
aaaaatatttatatagatattagcaatgaaacaaaaggtctttactaa

DBGET integrated database retrieval system