KEGG   Staphylococcus schleiferi 1360-13: LH95_06985Help
Entry
LH95_06985        CDS       T04012                                 

Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
ssch  Staphylococcus schleiferi 1360-13
Pathway
ssch00260  Glycine, serine and threonine metabolism
ssch00750  Vitamin B6 metabolism
ssch01100  Metabolic pathways
ssch01110  Biosynthesis of secondary metabolites
ssch01120  Microbial metabolism in diverse environments
ssch01230  Biosynthesis of amino acids
Module
ssch_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ssch00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    LH95_06985
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    LH95_06985
Enzymes [BR:ssch01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     LH95_06985
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP
Motif
Other DBs
NCBI-ProteinID: AKS67211
LinkDB All DBs
Position
complement(1471920..1472984)
Genome map
AA seq 354 aa AA seqDB search
MKLWKGLVEEYQSFLPVTDDTPKVTLNEGHTPLIYCDTISEMLGIELYVKYEGANPTGSF
KDRGMVMAVTKAKEQGRKIVICASTGNTSASAAAYAARAGLKAIVVIPEGKIALGKLSQA
VMYGAEIVSIEGNFDEALEIVKEVAQDGEIELVNSVNPYRIEGQKTGAFEIVDQLEGQAP
DVLAIPVGNAGNITAYWKGFKTYHDANQSELPQMFGFQAEGASPIVQNKVVKNPETIATA
IRIGNPASWEKAVQAIDESNGLIDAVTDEEILEAYQLMTSKEGIFSEPASNASIAGLIKL
HRQGRLKQGQRVVAVLTGNGLKDPDTAIGLLENPIQALPNNKESIIQYIKDALQ
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaattatggaaaggtcttgttgaagaatatcaatcatttttaccagtcacagatgat
acacctaaagtaacattaaatgaagggcatacgcctttaatttattgtgatacaatttct
gaaatgttaggtatcgaactctacgtcaaatatgaaggtgccaatcctacaggttcattt
aaagatagaggtatggtgatggcagtcactaaagctaaggaacaagggcgtaaaattgtg
atttgcgcatcaacaggcaatacatcagcttcggcagctgcttatgctgcaagagcaggt
ttaaaagcgattgtagttattccggaaggtaaaatcgcattgggtaaattatcacaagct
gtgatgtatggtgcagaaattgtttctattgaaggaaactttgacgaagctttagaaatc
gtaaaagaagtagcgcaagacggtgaaattgaattagtaaactctgtcaatccataccgt
attgaaggtcaaaaaacaggagcatttgaaattgtcgaccaacttgaaggacaagcacct
gatgttttagcgattcctgttggtaatgcaggcaatattacagcatattggaaaggattt
aaaacttatcatgatgcaaatcaatctgaattgccacagatgtttggctttcaagcagaa
ggcgcttcgcctattgttcaaaacaaagttgtgaaaaacccagagactatcgcaacggcg
attcgtattggtaatcctgcaagttgggagaaagcggtacaagctattgatgaatcaaat
gggctcattgatgctgtcacagatgaagaaattttagaagcttatcaattgatgacgtct
aaagaaggtatttttagtgagccagcaagtaatgcgtccattgcaggtctgattaaatta
catcgtcaaggtcgactcaaacaaggtcaacgtgttgttgcggtattaaccggaaatggt
ttaaaagacccagacactgcgattggtttattggagaacccaattcaagcattaccaaat
aataaggaaagtattattcaatatattaaggatgcgttacaatga

DBGET integrated database retrieval system