KEGG   Staphylococcus schleiferi 1360-13: LH95_08005Help
Entry
LH95_08005        CDS       T04012                                 

Gene name
sdhB
Definition
(GenBank) succinate dehydrogenase
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ssch  Staphylococcus schleiferi 1360-13
Pathway
ssch00020  Citrate cycle (TCA cycle)
ssch00190  Oxidative phosphorylation
ssch00650  Butanoate metabolism
ssch01100  Metabolic pathways
ssch01110  Biosynthesis of secondary metabolites
ssch01120  Microbial metabolism in diverse environments
ssch01130  Biosynthesis of antibiotics
ssch01200  Carbon metabolism
Module
ssch_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ssch_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ssch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LH95_08005 (sdhB)
   00650 Butanoate metabolism
    LH95_08005 (sdhB)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LH95_08005 (sdhB)
Enzymes [BR:ssch01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     LH95_08005 (sdhB)
    1.3.5.4  fumarate reductase (quinol)
     LH95_08005 (sdhB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_7 Fer4_10 Fer4_9 Fer4_17 Fer4_16 Fer4_2 Fer4 Fer4_15 Fer4_21 Fer4_18 Fer4_13 Fer4_6 Fer4_4 Fer4_3
Motif
Other DBs
NCBI-ProteinID: AKS67393
UniProt: A0A0K0ZVG3
LinkDB All DBs
Position
complement(1688249..1689052)
Genome map
AA seq 267 aa AA seqDB search
MAETAEKQPTETKTSNKTVTLIIKRQKDQNSKPYEETFVIPYRENMNVIAALMEIRRNPI
NDKGEKTTPVTWDMSCLEEVCGACSMVINGRARQSCSAIVDQLEQPIRLEPMNTFPVIRD
LQVDRTRMFDNLKRMKAWVPIDGTYDLGPGPRMPEKKRQTAYELSKCMTCGVCLEVCPNV
TSTNNFVGAQAISQVRLFNLHPTGAMTKDERLNALMDQGGLQACGNSQNCVQACPKGIPL
TTSIAALNRETSFHMFKSFFGSDHEVE
NT seq 804 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaacggcagaaaaacaaccaactgaaacaaaaacttctaacaaaacagttacg
ttaattattaaacgtcaaaaagatcaaaattcaaaaccttatgaagaaacatttgttatt
ccttatcgagaaaacatgaatgtgattgctgcattaatggaaattcgacgtaatccgatt
aatgataaaggggaaaaaacaacacctgtcacatgggatatgagttgcttagaagaggtt
tgtggtgcgtgttcaatggtgattaacgggcgtgcacgtcaatcatgttccgctattgtt
gatcaactagaacaaccgattcgacttgagcctatgaatactttccctgttatccgtgat
ttacaagtagaccgtacacggatgttcgataaccttaaacgtatgaaagcatgggtacct
atcgatggaacatatgacttaggaccaggacctcgtatgccagagaaaaaacgtcaaaca
gcatatgaattatctaaatgtatgacttgtggggtatgcttagaagtatgtccaaacgtg
acaagcactaacaattttgtaggcgctcaagctatttcgcaagtacgtttattcaacttg
catccaacaggcgctatgactaaagatgaacgtttaaatgcgcttatggatcaaggcggc
ttacaagcatgtggtaattcacaaaactgtgtgcaagcttgtcctaaaggtattccatta
acaacatcaattgctgcacttaatcgtgaaacatcattccatatgttcaaatcattcttt
ggttcagaccatgaagttgaataa

DBGET integrated database retrieval system