KEGG   Staphylococcus schleiferi 1360-13: LH95_08010Help
Entry
LH95_08010        CDS       T04012                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ssch  Staphylococcus schleiferi 1360-13
Pathway
ssch00020  Citrate cycle (TCA cycle)
ssch00190  Oxidative phosphorylation
ssch00650  Butanoate metabolism
ssch01100  Metabolic pathways
ssch01110  Biosynthesis of secondary metabolites
ssch01120  Microbial metabolism in diverse environments
ssch01130  Biosynthesis of antibiotics
ssch01200  Carbon metabolism
Module
ssch_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ssch_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ssch00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    LH95_08010 (sdhA)
   00650 Butanoate metabolism
    LH95_08010 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    LH95_08010 (sdhA)
Enzymes [BR:ssch01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     LH95_08010 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     LH95_08010 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 HI0933_like GIDA FAD_oxidored AlaDh_PNT_C NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: AKS67394
UniProt: A0A380HUA9
LinkDB All DBs
Position
complement(1689052..1690818)
Genome map
AA seq 588 aa AA seqDB search
MAEKKIIVVGGGLAGLMSTIKAAEQGAHVDLFSIVPVKRSHSVCAQGGINGAVNTKGEGD
SPWIHFDDTVYGGDFLADQPPVKAMTEAAPKIIHLLDRMGVMFNRTNEGLLDFRRFGGTL
HHRTAFAGATTGQQLLYALDEQVRSFEVDGYVTKYEGWEFLGIVKDEDNAARGIVAQNIT
TSEIQSFGSDAVIMATGGPGIIFGKTTNSMINTGSAASIVYQQGVKYANGEFIQIHPTAI
PGDDKLRLMSESARGEGGRIWTYKDGKPWYFLEEKYPDYGNLVPRDIATREIFDVCVNQK
LGINGENMVYLDLSHKDPHELDVKLGGIIEIYEKFTGDDPRKVPMKIFPAVHYSMGGLYV
DYDQMTNIDGLFAAGECDFSQHGGNRLGANSLLSAIYGGTVAGPNAVKYVENVEKSYVDM
DESMYQRRVEEEQARFDKLLNMKGTENAYKLHRELGEIMTANVTVVRHNDNLLETDKKIV
ELMKRYHDIDMEDTSQWSNQAVFFTRQLWNMLVLARVITIGAYNRNESRGAHYKPEFPNR
NDDEWLKHTLAEYKGPEEKPAFTYKPVDVSLIPPRKRDYTSKSKGGKK
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaagaaaattattgttgtcgggggcggacttgccggtctcatgtcaacaatt
aaagcagcggaacagggagcgcatgtagatttattctcaattgttccagtaaaacgctct
cactctgtttgtgcgcagggtggtattaatggagcagtcaacactaaaggtgaaggtgat
tctccatggatacacttcgacgatacagtttatgggggcgactttttagcggatcaacct
ccagttaaagccatgactgaagcagcgccgaagataatccacttattagatcgtatgggc
gtcatgtttaacagaacaaatgaaggtttattagacttccgacgttttggtggaacgcta
catcacagaactgctttcgcaggtgccacaacaggtcaacagttgctatatgcactagat
gaacaagttcgtagctttgaagtcgatggctatgtaacaaaatatgaaggttgggaattt
ttaggtatcgttaaagacgaggacaatgccgcacgtggtattgtagctcaaaatatcaca
acttcagaaattcaatctttcggttcagacgctgttattatggcaacaggtggcccgggt
attatcttcggtaaaacaacgaactctatgatcaatacaggttctgcagcttcgattgtt
tatcaacaaggggttaaatatgctaatggcgagtttattcaaatccatccaactgcaatt
ccaggcgacgataaacttcgtcttatgagtgaatccgcacgtggtgaaggtggacgtatt
tggacatacaaagatggtaagccatggtatttcttggaagaaaaatatcctgactatggt
aaccttgtaccgcgtgatattgcgacacgtgaaatttttgatgtctgcgtcaaccaaaaa
ctcggtatcaatggtgaaaacatggtataccttgatttatcacataaagatccacatgaa
ttagatgttaaactcggtggtatcattgaaatttatgaaaaatttactggtgatgatccg
cgtaaagtaccaatgaaaattttcccagcggttcactattcgatgggtggcctttatgta
gattatgatcaaatgacaaatatagatgggttatttgcagcaggagagtgtgacttttca
caacatgggggcaaccgcttaggtgccaactcactcttatccgcaatatatggcggaaca
gtagctggaccaaacgcagttaaatatgttgaaaatgttgaaaaatcatatgtcgacatg
gatgaaagtatgtatcaacgtcgtgtagaagaagagcaagcacgttttgataagttgttg
aatatgaaaggaacagaaaacgcatataaactacaccgtgaacttggtgaaattatgaca
gcgaatgtaacggtagtacgtcataacgataatcttttagagacggataaaaagattgtt
gaattaatgaaacgttaccacgatattgacatggaagatacatcacaatggagtaaccaa
gcggtcttctttacacgtcaattgtggaatatgcttgtactagcacgtgtaattacaatt
ggtgcatacaatcgtaacgaatcacgtggtgcacattataaacctgaattcccgaacaga
aatgacgatgagtggttgaaacatacattagctgagtataaaggaccagaagaaaaacca
gcattcacatataaaccagttgatgtaagcttaattccacctcgtaaacgtgactacaca
agtaagtcaaaagggggtaaaaaataa

DBGET integrated database retrieval system