KEGG   Sporothrix schenckii: SPSK_01139Help
Entry
SPSK_01139        CDS       T05555                                 

Definition
(RefSeq) 3-deoxy-7-phosphoheptulonate synthase
  KO
K01626  3-deoxy-7-phosphoheptulonate synthase [EC:2.5.1.54]
Organism
ssck  Sporothrix schenckii
Pathway
ssck00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ssck01100  Metabolic pathways
ssck01110  Biosynthesis of secondary metabolites
ssck01130  Biosynthesis of antibiotics
ssck01230  Biosynthesis of amino acids
Module
ssck_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:ssck00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SPSK_01139
Enzymes [BR:ssck01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.54  3-deoxy-7-phosphoheptulonate synthase
     SPSK_01139
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DAHP_synth_2
Motif
Other DBs
NCBI-GeneID: 27663347
NCBI-ProteinID: XP_016584051
UniProt: A0A0F2LY09
LinkDB All DBs
Position
Unknown
AA seq 484 aa AA seqDB search
MSAPNGAPDGWTPSSWRSKPIKQSPAYDDPEAVARATRELQRLPPIVHPGEILRLKQHLA
AVARGDAFLLQGGDCAELFDYCEPNAIESKIKLLLQMSLVLIWGADKPVVRIGRMAGQYA
KPRSSPNETLPDGRTVPSFRGDILNGYELDQRELDPQRLVRAYHHSAATLNYVRSAIAAG
IADLHHPLDWGLGHVRDPALKAKYSEAVTFLTDMLRFMHTIGADKNDKLDTVDLYTSHEA
LVLEYEEPMTRLLPATRGRLRRDTNGHSTTTTTTSAPPSAYFDTSAHFLWIGDRTRQVDH
AHVEFFRGLANPVGIKVGPTTPPEDLLTILRALNPQREPGKVTLITRYGAARVRELLPAH
IRIVEGSEYRRCVVWQCDPMHGNTQTTATAGIKTRHFADILAELRETLQVHTDEGSYLGG
VHLELTGDAVTECLGGSEGLDEDDLSTNYTSFCDPRLNEKQALEMAFLIADHHRTVRQGA
SASK
NT seq 1455 nt NT seq  +upstreamnt  +downstreamnt
atgtctgcaccaaacggcgcaccagacggctggacacccagctcgtggcgctcaaagccc
atcaagcagagcccggcctacgatgaccccgaggccgtcgcccgcgcaacccgtgagctg
cagcgtcttccgcccattgtgcacccgggcgagatcctgcgtctgaagcaacacctggcc
gccgtggcccgcggcgatgcgttcctgctgcaaggcggcgactgtgccgagctctttgac
tactgcgagcccaacgccatcgagtccaagatcaagctgcttctgcagatgagtcttgtc
ctgatctggggcgccgacaagcccgtcgtgcgcatcggccgcatggccggccagtacgcg
aagccccgctccagccccaacgagacgctgccggacggccgcaccgtgccctcgttccgc
ggcgacattctcaacggctacgagctcgaccagcgcgagctggacccccagcgcctcgta
cgcgcctaccaccattcggccgcgaccctcaactatgtgcgctcggccattgccgccggc
atcgccgatctgcaccatcctctggactggggtctgggccatgtgcgggatccggcgctc
aaggccaagtactcggaggcggtgacgttcctgacggacatgctgcgcttcatgcacacg
attggcgccgacaagaacgacaagctcgacacggtcgacctgtacacgagccacgaggcg
ctggtgctcgagtacgaggagcccatgacgcgtctgctgccggcgacccgcggccgcctg
cgccgcgacaccaacggccactcgacgacgacgacgacgacgagcgcaccaccgtcagcc
tactttgacacatcggcgcacttcctctggatcggcgaccgcacccgccaggtcgaccac
gcgcacgtcgagttcttccgcggcctcgccaacccggtcggtatcaaggtcggccccacg
acgccgcccgaggacctgctgaccattctgcgggcgctcaacccgcagcgcgagccgggc
aaagtcaccctcattacgcgctacggcgccgcccgcgtgcgcgagctgctgcccgcgcac
atccgcattgtcgagggcagcgaataccgccgctgcgttgtctggcagtgcgaccccatg
catggcaacacgcagacgacggcgacggcgggcatcaagacgcgccactttgccgacatc
ctggccgagctccgcgagacgctgcaggtccacaccgacgagggcagctacctgggcggc
gtgcacctggagctgacgggcgacgccgtgaccgagtgtctgggcggctccgagggactg
gacgaggacgacctgtcgaccaactacacgagcttctgcgacccgcggctcaacgagaag
caggcgctggagatggcctttttgattgcagaccaccacaggacggtgcggcaaggcgcg
tccgcgtcgaagtag

DBGET integrated database retrieval system