KEGG   Sporothrix schenckii: SPSK_02231Help
Entry
SPSK_02231        CDS       T05555                                 

Definition
(RefSeq) beta-galactosidase
  KO
K01190  beta-galactosidase [EC:3.2.1.23]
Organism
ssck  Sporothrix schenckii
Pathway
ssck00052  Galactose metabolism
ssck00511  Other glycan degradation
ssck00600  Sphingolipid metabolism
ssck01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssck00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SPSK_02231
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    SPSK_02231
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SPSK_02231
Enzymes [BR:ssck01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     SPSK_02231
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro2_C5 Glyco_hydro_2_C DUF4982 Glyco_hydro_2_N Glyco_hydro_2 BetaGal_dom4_5 Invasin_D3
Motif
Other DBs
NCBI-GeneID: 27664381
NCBI-ProteinID: XP_016588864
UniProt: A0A0F2M910
LinkDB All DBs
Position
Unknown
AA seq 888 aa AA seqDB search
MPSSRVSERLSVLLCVLIWLAGLHSVAAHAVSRDTPSDGDPATAAAHHQVRQRLSLNKGW
RFSRFTSNPDSLSYATLKPWMLASSTKFTPSKAQPPVVPSTTPAAINAKYAQAGFDDSAW
EAVNVPHDWAIKGPFGAPGVSGGMGRLPSNGVGWYRRNVTLEAADKGKSVFLDIDGAMSY
AAVWLNGHLVGGWPYGYASFRLDLTPYVVAGGDNTLAIRLDNALDNSRWYPGAGIYRNIW
LVKVDPVHVDQFGTFVTTPAVSADSATAHLVVEVENTATESRQVDVHTEVHVFDAATRSA
AKDVVVAFAKTALTVPAGSTAWTNSSATIPSPLLWGPPPDQKPHLYVAVTTLSVNGSVVD
TYETRFGVRSITYDANHGLFVNGKKVRVQGTNNHHDQGALGAAFHVRAAERQLEMLQDFG
CNALRTSHNPPAPELVDLADEKGFLVFDEIFDSWAGAKTTNDFHLIFSDWHEADLRAFVR
RDRNHPSVIVWSYGNEIGEQKSDSSRRVAQELHDMIHSEDPTRPTTASMNSAGAGSAFAD
VMDVESLNYQGEGMGTSNFSSFPSFHKAYPNKMIWTSESASTLSSRGTYIFPVTSAYSAI
VGSNSGGDDANMYVSAYDLYAPSWASSPDKVFAMQDEHPYVAGEFVWTGFDYIGEPTPYN
NARSSYFGIIDLAGFRKDRFYMYQARWRPDVPMAHILPHWTWPDRVGKVTPVHVFSSGDE
AELFVNGQSAGRLKKAEYTYRFRWDNVTYAAGDLRVVTYKNGKEWAVDAVKTVGAATHLN
LVADRTTIAGDGLDLSYLTASVVDADGNTVPQANNAITFTVAGAGELVATDNGDPTDMTA
FPSATRKAFSGLALAIVRAKGSDDAGKNATVSASAPGLKGAQVTLTLS
NT seq 2667 nt NT seq  +upstreamnt  +downstreamnt
atgccctcttctagggtctcggaacgcctcagcgtgctcttgtgcgtgctaatctggcta
gctggtctgcactctgtcgcggcacatgccgtcagcagagatactcccagtgacggcgac
ccggcgacagcggcggctcatcaccaggtccgccagcggctgagcctcaacaagggctgg
cgcttttcacgcttcacgtccaacccggactcgctctcgtacgccacgctcaagccatgg
atgcttgcgtcgtccaccaaattcaccccatccaaggcccagccgcccgtggtgccctcc
acaactcccgcagccatcaatgccaagtatgcacaggcggggtttgacgacagcgcgtgg
gaggctgtgaatgtgccgcacgactgggctatcaagggcccttttggcgcgccgggcgtg
agtggcgggatgggccgtctgccgtccaacggtgtgggctggtaccgccgcaacgtgaca
ttggaggccgcagacaagggaaagtcggtgtttctcgacattgatggcgccatgtcgtat
gcggctgtgtggctcaacggccatctcgtgggcggctggccttacggctatgcctcgttc
cgcttggacttgaccccgtatgttgtggccggcggcgacaacactctggccattcgcctc
gacaacgcactggacaactcgcgctggtacccgggcgccggcatctaccgcaacatctgg
ctcgtcaaggtggatcctgtgcatgtggaccagttcggcacctttgttacgacgccagct
gtctccgccgacagcgccacggcccatcttgttgtcgaggttgagaacacggccacggag
agccgccaggtcgacgttcacaccgaggtgcacgtctttgacgcagccacgcgcagcgct
gccaaggacgttgtcgttgcgtttgcaaagacagccctcactgtgcccgccggcagcact
gcatggaccaacagctcggccaccattcccagcccgctgctctggggtccacctcccgac
caaaagccccatctgtacgtcgctgtaaccactctgtctgtcaacggctccgtcgtcgac
acgtacgagacccggtttggtgtccgcagcatcacgtacgacgccaaccatggtcttttc
gtcaatggtaagaaggtgcgcgtccagggcacgaacaaccaccacgaccagggagcgctc
ggtgccgccttccacgtgcgcgctgccgagcgccagctggagatgctccaagactttggt
tgcaacgccctgcgcacctcgcacaacccgccggcgcctgagctggtagaccttgccgac
gagaagggcttcttggtctttgacgagatctttgacagctgggccggcgccaagaccacc
aacgacttccacctcatcttctccgactggcacgaggccgatttgcgtgcgtttgtccgc
cgcgaccgcaaccacccgtccgtcatcgtgtggagctatggcaacgagattggcgagcag
aagagcgactcgtcgcggcgggtggcccaggaattgcacgacatgatccattccgaggac
ccaacgcggccgaccacggcgtccatgaactcggcgggggccggcagcgcgttcgccgat
gtcatggacgtggagagtctcaactaccagggcgagggcatgggcacgtcgaacttctcg
tccttcccaagcttccacaaggcataccccaacaagatgatctggaccagcgagagcgct
tcgacgctgagctcgcgcggcacatacatcttccccgtcacgtctgcgtacagtgccatt
gtgggcagcaattcgggcggcgacgacgccaacatgtacgtcagcgcctacgacctgtac
gccccgtcctgggcctcgtcgcccgacaaggtgtttgcgatgcaagacgagcacccgtac
gtggccggcgagtttgtctggacgggcttcgactacattggcgagccgacgccgtacaac
aatgcacgcagctcgtactttggcatcatcgacttggctggtttccgcaaggaccgcttc
tacatgtaccaggcacgctggcgcccggacgtgcccatggcccacatcctgccgcactgg
acgtggcccgaccgggtgggcaaggtcacgcccgtgcacgtcttttcgtccggcgacgag
gccgagctgtttgtcaatggccagtcggccggccgcctcaagaaggccgagtacacctat
cgtttccgctgggacaacgtcacctatgccgcgggggacctccgcgtcgtcacgtacaag
aacggcaaggagtgggctgtcgacgccgtcaagaccgtcggcgctgccacccacctgaac
ttggtcgccgaccgcacgacgatcgcgggcgacggtcttgatctgtcgtacctgaccgcg
agtgtggtcgacgccgacggcaacacggtgccgcaggccaacaacgccatcacgttcacg
gtggcgggcgccggcgagctcgtcgcgacggacaacggcgacccgacggacatgacggcg
tttcccagcgcgacgcgcaaagcctttagcggtctggcacttgccattgtgcgggccaag
ggctcggacgacgccgggaagaatgcgactgtatcggcgagtgcgccgggtctgaagggc
gcacaggtgacattgactttgtcgtga

DBGET integrated database retrieval system