KEGG   Sporothrix schenckii: SPSK_03169Help
Entry
SPSK_03169        CDS       T05555                                 

Definition
(RefSeq) glucoamylase
  KO
K01178  glucoamylase [EC:3.2.1.3]
Organism
ssck  Sporothrix schenckii
Pathway
ssck00500  Starch and sucrose metabolism
ssck01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssck00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SPSK_03169
Enzymes [BR:ssck01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.3  glucan 1,4-alpha-glucosidase
     SPSK_03169
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_15 CBM_20
Motif
Other DBs
NCBI-GeneID: 27665287
NCBI-ProteinID: XP_016585095
UniProt: A0A0F2LZZ5
LinkDB All DBs
Position
Unknown
AA seq 635 aa AA seqDB search
MPSLRSWAVAALTLARTVLGAPSRVDPRADVGTWLDSEAAVAVERILSNIGSSGQYAASA
KSGIVIASPSTSNPDYYYTWSRDAALVMKTLIEVFRNGDASVQSAITHYIDSQATLQTVS
NPSGQLSDGSGLGEPKFNVDETAFTGSWGRPQRDGPALRATALVGFGNWLLDNGYASYAT
ANVWPVVRNDLAYVAQYWNQTGYDLWEEVSGSSFFTVSAQHRALVEGSAFATRVGSSCPS
CTAIAPQILCYMQSFWTGSYMNANFGGGRTGKDANTVLASIHAFDPTAACDDATFQPCSS
RALANHKVYTDSFRSVYALNSGKAEGVAVAVGRYPEDSYYNGNPWYLTTLAAAEQLYDAL
YTWNRIGSLTIDSTSLAFFKDLYSSAAVGTYSATSAAYASIVAAAKTYADGYVSIVETYA
MANGSMSEQYDKSSGSPLSARDLTWSYAALLTAKMRRDSVVPPSWGETSASSVPSVCSAT
SVSGSYSTAAVGSWPSSLASGTATTSPTSTSSGTGGATSTSTTSTTACTTPTAVAVTFNE
IATTSYGENVFLTGSLSVLGNWDTSSAIALSAADYTSSDHKWFVTLNLPAGTTFQYKYIR
KEADGSVVWESDPNRSYTVPKGCNTATATENDTWR
NT seq 1908 nt NT seq  +upstreamnt  +downstreamnt
atgccgtccctccgttcctgggccgtggcggccttgaccctcgctcggaccgtcctaggt
gccccgtcgcgcgttgacccccgcgccgacgtcggcacctggctggactccgaggccgcc
gtcgccgtcgaacgcattcttagcaacattggcagttctggccagtacgccgccagcgcc
aagtcgggcattgtcattgcctcgccgagcacgtccaaccccgactactactacacgtgg
agtcgtgatgctgcccttgtcatgaagacgcttatcgaggtcttccgcaacggcgacgcc
agcgtccagtccgccattacgcactacatcgacagccaggcgactctccagaccgtctcc
aacccgtctggccagttgtccgacggctccggtcttggcgagcccaagttcaacgtcgac
gagaccgccttcactggatcctggggccgcccccagcgtgacggccctgccctgcgtgcc
acggcgctcgtcggctttggcaactggctgctcgacaacggctacgccagctatgctacg
gccaatgtctggcccgtcgttcgcaacgatctggcctacgtcgcccagtactggaaccag
accggctacgatctctgggaggaggtcagcggctcgtccttcttcaccgtgtccgcccag
caccgcgctctggtcgagggcagcgcctttgccacccgcgtcgggtcctcgtgcccgagc
tgcaccgccattgcgccccagattctgtgctatatgcagtccttctggaccggcagctac
atgaacgccaactttggcggcggccgcaccggtaaggatgccaacacggtcctcgccagc
atccacgcctttgacccgaccgccgcctgcgacgacgccaccttccagccctgctcctcg
cgcgctcttgccaaccacaaggtctacaccgactcgttccggtctgtctacgcgctcaac
tctggcaaggccgagggtgttgctgttgccgttggccgctatcccgaggactcgtactac
aacggcaacccctggtacctgaccacactcgctgccgcggagcagctgtacgacgccctg
tacacctggaaccgcatcggctccctgacgatcgacagcacctcgctcgccttcttcaag
gatctctacagcagcgctgccgtcggcacctatagcgccacgtccgccgcctacgcctcc
attgttgctgctgccaagacttacgccgacggctacgtcagtatcgtggaaacgtacgcc
atggccaacgggtccatgtcagagcagtacgacaagtcgtccggctcgccgctgtccgcc
cgcgacctgacctggtcctacgccgcgctgctgaccgccaaaatgcgccgcgactccgtc
gtcccgccgtcctggggcgagacgtccgcttccagcgtgccctctgtctgctctgcgacg
tcggtgtctggctcgtacagcacggccgccgtcggatcgtggccgtccagcctggccagc
ggcaccgcgacgacctcgccgacctcgacgtcgtccggcacgggcggtgccacctcgact
tccaccacttccaccactgcttgtaccaccccgacggctgtcgccgtcaccttcaacgag
atcgccaccacgagctacggcgagaacgtcttcttgacgggctccctttctgtcctcggc
aactgggacaccagcagcgccattgccctgagcgcggccgactacacgtcgagcgaccac
aagtggttcgtcaccctcaacctgcccgccggtaccacgttccagtacaagtacatccgc
aaggaggccgacggctctgttgtctgggagagcgaccccaatcgctcctacactgtgccc
aagggctgcaacaccgccacggccacggaaaacgacacttggcgatga

DBGET integrated database retrieval system