KEGG   Sporothrix schenckii: SPSK_04159Help
Entry
SPSK_04159        CDS       T05555                                 

Definition
(RefSeq) glutamate decarboxylase
  KO
K01580  glutamate decarboxylase [EC:4.1.1.15]
Organism
ssck  Sporothrix schenckii
Pathway
ssck00250  Alanine, aspartate and glutamate metabolism
ssck00410  beta-Alanine metabolism
ssck00430  Taurine and hypotaurine metabolism
ssck00650  Butanoate metabolism
ssck01100  Metabolic pathways
ssck01110  Biosynthesis of secondary metabolites
Module
ssck_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ssck00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    SPSK_04159
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SPSK_04159
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SPSK_04159
   00430 Taurine and hypotaurine metabolism
    SPSK_04159
Enzymes [BR:ssck01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.15  glutamate decarboxylase
     SPSK_04159
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pyridoxal_deC Aminotran_5 OKR_DC_1 DegT_DnrJ_EryC1
Motif
Other DBs
NCBI-GeneID: 27666247
NCBI-ProteinID: XP_016586525
UniProt: A0A0F2M428
LinkDB All DBs
Position
Unknown
AA seq 525 aa AA seqDB search
MVHLAEIKHEDATTGKHIDKEVKKSHLQLANDADCFTTSVYGSRFASADLPRHEIPETEM
PKEVAYRMIKDELSLDGNPMLNLASFVTTYMEEEAEKLMTESFSKNFIDYEEYPQSAEIQ
NRCVSMIGRLFNAPVGPESGAGAVGTSCVGSSEAIMLGVLAMKRRWKNKRKAEGKSYENP
NIIMSSAVQVCWEKATRYFEIEEKLVYCTPDRFVIDPKQVVDLIDENTIGICCILGTTYT
GEYEDVKAVNDLLVERNLDVPIHVDAASGGFVAPFVMPGLEWDFRLPKVVSINVSGHKYG
LVYPGVGWVVWRSAEYLPQELVFNINYLGADQSSFTLNFSKGASQVIGQYYQLIRLGKHG
YRAIMSNLTRTADYLSDSLEKLGFVIMSKKSGEGLPLVAFRLPDVREKTDDGSERVYDEF
ALAHQLRVRGWVVPAYTMAPNTDGLKMLRVVVREDFTWNRCDALISDIKLCMSFLENMDK
EALRKTQEFVRDHHLASSRAEHNHPKFRNEEHSIQGKTGKTHAIC
NT seq 1578 nt NT seq  +upstreamnt  +downstreamnt
atggtccatctcgccgagatcaagcatgaagatgccaccaccggcaagcacatcgacaag
gaggtcaagaagtcccacctccagctcgccaacgatgccgactgcttcaccacctctgtc
tacggctcccgcttcgcctcggccgacctgccccgccacgagatccccgagaccgagatg
cccaaggaggtcgcctaccgcatgatcaaggacgagctcagcctggacggcaaccccatg
ctcaacctcgcctctttcgtcaccacctacatggaggaagaggccgagaagctcatgacc
gagtcgttctccaagaactttatcgactacgaagagtacccccagtccgctgagatccag
aaccgctgtgtctccatgatcggtcgcctcttcaacgccccggtcggccccgagtccggc
gctggcgccgtcggcacgtcttgtgtcggttcgtccgaggccatcatgctcggtgtcctg
gccatgaagcgccgctggaagaacaagcgcaaggctgagggcaagtcgtacgagaacccc
aacatcatcatgtcctcggccgtccaggtctgctgggaaaaggccacccgctactttgag
attgaggagaagctcgtctactgcaccccggaccgcttcgtcatcgacccgaagcaggtc
gtcgacctcatcgacgagaacaccattggcatctgctgcatcttgggcaccacctacacc
ggcgagtacgaggacgtcaaggccgtcaacgacctgctggtcgagcgcaacctcgacgtc
cccatccacgtcgatgccgccagcggtggcttcgtcgcccccttcgtcatgcccggcctc
gagtgggacttccgtctgcccaaggttgtgtccatcaacgtgtctggccacaagtacggt
cttgtctaccccggtgtcggctgggtcgtctggcgctccgccgagtacctgccccaggag
ctcgtcttcaacatcaactacctgggcgccgaccagtcgtccttcaccctcaacttcagc
aagggcgcctcccaggtcattggccagtactaccagctgatccgcctcggcaagcacggc
taccgcgccatcatgtccaacctcacccgcaccgccgactacctgtccgactcgctcgag
aagcttggctttgtcatcatgtccaagaagtcgggcgagggtctgccccttgtcgccttc
cgcctgcccgacgtcagggagaagaccgacgacggtagcgagcgcgtctacgacgagttt
gcccttgcccaccagctgcgcgtccgcggctgggtcgtccccgcctacaccatggccccc
aacaccgacggcctcaagatgctgcgcgttgtcgtccgcgaggactttacctggaaccgc
tgcgacgccctcatttccgacatcaagctgtgcatgtccttcctcgagaacatggacaag
gaggccctccgcaagacccaggagtttgttcgcgaccaccacttggctagctcccgcgcc
gagcacaaccaccctaagttccgcaacgaagaacactcgatccagggcaagactggcaag
acgcatgctatctgctaa

DBGET integrated database retrieval system