KEGG   Sporothrix schenckii: SPSK_04895Help
Entry
SPSK_04895        CDS       T05555                                 

Definition
(RefSeq) alpha-glucosidase
  KO
K01187  alpha-glucosidase [EC:3.2.1.20]
Organism
ssck  Sporothrix schenckii
Pathway
ssck00052  Galactose metabolism
ssck00500  Starch and sucrose metabolism
ssck01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssck00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    SPSK_04895
   00500 Starch and sucrose metabolism
    SPSK_04895
Enzymes [BR:ssck01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.20  alpha-glucosidase
     SPSK_04895
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_31 NtCtMGAM_N Gal_mutarotas_2
Motif
Other DBs
NCBI-GeneID: 27666932
NCBI-ProteinID: XP_016583554
UniProt: A0A0F2LTS7
LinkDB All DBs
Position
Unknown
AA seq 1057 aa AA seqDB search
MVATSTVLAGAWWVAAGLCASDSTATATSSAVRAQFTVPESADVGQNLLPWINDPEAIDP
QAVCPGYIATAVTSSGGHHHDSHGRDANTTASGVGATFSAYLDLAGEPCHVYGNDVEHLV
LTLELQAVDRVRVNIAPRYIGAQNASWFELPEVLVPTPSGTYSPPAATSSRAVRHHAASG
DAAAGGSLTQSDLAFSWSNSPTFGFALTRISTGDVLFSTNGTKLVYEDQFIEFVSPLPEN
YNLYGLGEVIHGFRLGNNLTRTIFAADAGDPIDGNIYGSHPFYLDTRYFDKATGKYAANA
TAGCSSSPTAYESYTHGVFLRNAHPQEVLLRESNITWRALGGEIDLYFYAGPSAPDVMQS
YQQTTVGLPALQQYFAFGYHQSRWGYENWTVLQGVVDNFKAADIPLETIWTDIDYMNQYR
DFDNDQTRFGYAEGADFLRRLHTNGQHYVPIVDSAIYVPNPSNKSDAYPVFDRGVAADAF
LLNPNGSLYIGQVWPGYTVFPDWIGAVLNGSGAFGWWTNEVVNWHKNVSFDGIWIDMSEV
SSFCVGSCGSNNLTLNPVHPSFLLPGEPNNLITQFPEGFNITNSTEASSASSVASSQAAA
TSTPASPSTSTTYLRTTATPGTRNVNYPPYVINNVQGDLAVHAVSPNATHHGGVLEYDTH
NLYGHQILNATYNALLSVFPGKRPFIIGRSTFAGSGKWAGHWGGDNTSLWAYMVFSIAQA
LSFSVFGVPMFGVDTCGFNGNSDMELCARWMQLSAFFPFYRNHNTLSAISQEPYVWAAVA
DASRTAMAIRYSLLPYMYTLFADAHDTGAPVMRALAWEFPTEPWLASADLQFMLGPALLV
TPCLEQGATTVNGVFPGGSSSGSGSSGSSSGSASDTLWYDWYNQTAVNSSWVAPGNNVTI
DAPLGHIPVFVRGGHVLPMQKPGMTTAESRANDWNLLVALDAKGGAVGKLYLDDGESVHP
NATTWVHFAASSGQLTATSTGNYTSSGSSSGSGSAPALANVTIMGVACQPSNVSWNGTAL
KNTQWTYGKSTQLLQVTGLQDSTSAGIWDGKWNLSWA
NT seq 3174 nt NT seq  +upstreamnt  +downstreamnt
atggtcgctacgtccaccgtgctggccggtgcttggtgggtggctgcgggcctctgtgcc
tccgatagtacggccacggccacgagctcggccgtcagagcccagttcactgtccccgag
tcagccgatgtcggccagaacttgctgccctggatcaacgaccctgaggccatcgacccg
caggctgtgtgccctggctacattgcaacggccgtgacctcgagcggtggtcaccaccac
gacagccacggccgcgatgccaacaccaccgcttcgggcgttggtgctaccttttccgcc
tacctggacctcgccggcgagccctgccacgtgtacggcaacgacgtcgagcacctggtg
ctgacgctcgagctgcaggccgtcgaccgtgtgcgtgtcaacattgcgccgcgctacatt
ggtgcccagaatgcctcctggttcgagctgcccgaagtgctggtgcccacaccgtccggg
acctactcaccgccggccgcaacgtcgtccagagccgtgagacaccacgcagcttccggg
gatgcagctgccggcggctcgctgacgcagtcggacctggcattcagctggtccaactcg
cccacgtttggcttcgccctcacccgcatctccacgggcgacgttctcttctcgaccaac
ggcacgaagcttgtgtacgaggaccagtttatcgagtttgtctcgcccctgcccgagaac
tacaacctatacggcctcggcgaggtgatccacggtttccgtctcggcaacaacctgacg
cgcactatatttgccgccgatgcgggcgaccccattgacggaaacatttatggcagccac
ccattctacctggatacgcgctactttgacaaagccaccggcaagtacgctgccaacgcc
acggccggttgcagctcgtcgccgaccgcgtacgagtcctacacacatggcgtcttcctc
cgcaatgcccatccccaggaggtgctcctgcgcgagtccaacatcacctggcgtgcgctc
ggcggcgagatcgacctgtacttttacgccggcccctctgcccccgacgtcatgcagtcc
taccagcagaccaccgtcggtcttcctgccctgcagcagtactttgcctttggctaccac
cagagccgctggggctacgagaactggaccgtcctgcagggcgtcgtcgacaacttcaag
gccgccgacatcccgctcgagaccatctggacggacattgactacatgaaccagtaccgc
gactttgacaacgaccagacgcgcttcggctatgccgagggcgccgacttcctccgccgc
ctgcacaccaatggccagcactacgtccccattgtggactcggccatctacgtgcccaac
cccagcaacaagagcgacgcctaccccgtcttcgaccgcggcgtcgctgccgacgccttt
ctgctcaaccccaatggctcgctctacattggccaggtctggccgggctacaccgtcttc
cccgactggatcggcgctgtgctcaacggctccggcgcctttggctggtggaccaacgag
gtcgtcaactggcacaagaacgtgtcctttgacggcatctggatcgacatgtccgaggtc
tcgtcgttttgcgtcggctcctgcggcagcaacaacctgacgctcaaccccgtccacccc
agcttcctgctgcccggcgagcccaacaacctcatcacccagtttcccgagggcttcaac
atcaccaacagcacagaggcgtcgtcggcgtcgtctgtcgcgtcgtcgcaggctgcggcc
acctcgacgcccgcctcgccgtcgacgagcaccacgtacctccgcacaacggcgacgccc
ggcacccgcaacgtcaattacccgccctacgtcatcaacaacgtccagggcgacttggct
gtgcatgccgtcagccccaacgcgacgcaccacggcggcgtgctcgagtacgacacccac
aacctctacggccaccagattctgaatgccacctacaatgccctgctgtccgtcttcccc
ggcaagcggcccttcatcatcggacgctcgacgtttgccggctctggtaaatgggctggc
cactggggcggcgacaacaccagcttgtgggcctacatggtcttttccatcgcccaggcg
ctctctttctccgtctttggggtccccatgttcggcgtcgacacctgcggtttcaacggc
aactccgacatggagctgtgcgcccgctggatgcagctgtctgccttcttccccttttac
cgcaaccacaacaccctgagcgccatttcacaggaaccctatgtgtgggccgcggtcgcc
gacgcctcgcggactgccatggccatccgctacagcctgctgccgtacatgtatacgctc
tttgccgacgcccacgacaccggcgccccagtcatgcgggccctggcctgggagttcccc
accgagccctggctggccagtgccgatctccagttcatgctgggcccggccctgctggtc
acaccgtgtctcgagcagggcgcaacgacggtgaatggcgtgttcccgggcggttcgagc
agcggctccggcagctccggcagctcttccggttcggcttcggacacgctctggtacgac
tggtacaaccagaccgccgtcaattcgtcttgggtggcgcctggcaacaatgtcaccatc
gacgcgccccttggccacattcccgtctttgtccgcggtggccacgtcctgcccatgcag
aagcccggcatgacgactgccgaatcacgcgccaacgattggaacctactggttgcccta
gacgccaagggcggcgcggtgggcaagctgtacctcgacgacggcgagagcgtgcacccc
aacgcaacgacctgggtgcactttgcggcatcgtcgggccagctgacggcgacgtccact
ggtaactacacctcgagcggcagcagcagtggcagtggcagcgcccctgctctggccaac
gtcaccatcatgggtgtggcctgccaaccatccaacgtctcgtggaatggcactgccctc
aagaacacccagtggacctacggcaagagcacgcagctcctgcaggtcactggcctgcag
gacagcaccagtgcaggtatctgggacggcaagtggaacctgtcctgggcatag

DBGET integrated database retrieval system