KEGG   Sporothrix schenckii: SPSK_07908Help
Entry
SPSK_07908        CDS       T05555                                 

Definition
(RefSeq) superoxide dismutase, Fe-Mn family
  KO
K04564  superoxide dismutase, Fe-Mn family [EC:1.15.1.1]
Organism
ssck  Sporothrix schenckii
Pathway
ssck04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ssck00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    SPSK_07908
Enzymes [BR:ssck01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     SPSK_07908
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Fe_C Sod_Fe_N
Motif
Other DBs
NCBI-GeneID: 27669838
NCBI-ProteinID: XP_016590318
UniProt: A0A0F2MDC0
LinkDB All DBs
Position
Unknown
AA seq 215 aa AA seqDB search
MSAKIYSLPALPYAYNALEPNISAQIMELHHKRHHQAYVDNLNKALQSLTVAIATGDAAT
QVSLQEAIRFNGGGHINHSLFWRNLAPAGRPESDPSGAAAPTLVQDINQTWGSVDNFKKF
FSAALLGIKSSGWGWLVLEPATGLHIVTTKDQDSPVGGEIPILSVDMWEHAYYLQYLNGK
AAYVENIWKVINWQTAEERYLRGPPDAAKIIAEAV
NT seq 648 nt NT seq  +upstreamnt  +downstreamnt
atgtctgccaaaatctactcgctgccggccctaccgtacgcctacaatgcgcttgagccc
aatatctctgcccaaatcatggaactgcaccacaaacgccaccaccaggcctatgttgac
aaccttaacaaggcgctgcagtcactaaccgtagccatcgcgacgggggatgccgccacg
caggtgtccctccaggaggctatccgattcaacggcggcggtcatatcaaccactcgctg
ttctggcggaaccttgctccggccggtagacccgagtcggatccttcgggcgctgccgcc
ccgactctggtccaggatatcaaccagacatggggcagcgttgataacttcaagaagttc
ttttcggctgcgctgctgggcatcaaaagcagcggctggggatggctagtgctggagcca
gccacaggcttgcacatcgtgacaaccaaggaccaggactcgccggtcggcggcgagatt
cccatcctgagcgtcgacatgtgggagcacgcctactacctgcagtacctgaatggtaag
gcggcctatgtcgaaaacatctggaaggtcatcaactggcagacagcagaggaacggtat
ctgcgcggaccgccggacgcggccaagataattgctgaagctgtttga

DBGET integrated database retrieval system