KEGG   Sporothrix schenckii: SPSK_08603Help
Entry
SPSK_08603        CDS       T05555                                 

Definition
(RefSeq) succinate dehydrogenase (ubiquinone) flavoprotein subunit
  KO
K00234  succinate dehydrogenase (ubiquinone) flavoprotein subunit [EC:1.3.5.1]
Organism
ssck  Sporothrix schenckii
Pathway
ssck00020  Citrate cycle (TCA cycle)
ssck00190  Oxidative phosphorylation
ssck01100  Metabolic pathways
ssck01110  Biosynthesis of secondary metabolites
ssck01130  Biosynthesis of antibiotics
ssck01200  Carbon metabolism
Module
ssck_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ssck_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ssck_M00148  Succinate dehydrogenase (ubiquinone)
Brite
KEGG Orthology (KO) [BR:ssck00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPSK_08603
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SPSK_08603
Enzymes [BR:ssck01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SPSK_08603
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Thi4 GIDA Pyr_redox_2 FAD_binding_3 DAO
Motif
Other DBs
NCBI-GeneID: 27670472
NCBI-ProteinID: XP_016587086
UniProt: A0A0F2M6I2
LinkDB All DBs
Position
Unknown
AA seq 645 aa AA seqDB search
MASTGAWKRLAAIARPAFQSSRTFSSTPRAARVFANGPLRAKEASSFVSSKYPVIDHEYD
ALVVGAGGSGLRAAFGLAEAGFNTACISKLFPTRSHTVAAQGGINAALGNMHKDDWRWHM
YDTVKGSDWLGDQDAIHYMTREAPASIIELENYGCPFSRTDEGKIYQRAFGGQSREYGKG
GQAYRCCAAADRTGHALLHTLYGQSLRHNTNYFIEYFVIDLIMEDGECRGVLAYNQEDGT
LHRFLANHTVLATGGYGRAYFSCTSAHTCTGDGMAMVARAGLPNQDLEFVQFHPTGIYGA
GCLITEGARGEGGYLLNSEGERFMERYAPTAKDLASRDVVSRSMTLEIREGRGVGPDKDH
IYLQLSHLPAEVLAERLPGISETASIFSGVDVRKQPIPVLPTVHYNMGGIPTKYTGEVLT
VDDNGNDKVVPGLYACGEAACVSVHGANRLGANSLLDLVVFGRAVSHQIRDTSSPGAKLK
PLRADAAADSIEYLDKIRNADGPRSTAEIRLAMQKTMQTDVSVFRTQESLDEGVRNINKV
DNTFSEVGIKDRSMIWNSDLVETLELRNLLTCATQTATAAANRKESRGAHAREDYPERDD
ANWMKHTLTFQREPHGPVDLKYRKVISTTLDENECKPVPPFKRVY
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
atggcgtccacaggggcttggaagcggctggcagcaattgcccggccagctttccagtct
tccagaaccttctcttctacgccgcgtgccgctcgcgtcttcgcaaacggcccgcttcgc
gccaaggaggcttcctcgttcgtgagcagcaagtacccagtcattgaccacgagtacgat
gcccttgttgtcggtgccggtggctccggtctgcgtgccgctttcggtctggccgaggcg
ggcttcaacactgcctgcatatcgaagctgtttcccacgcgctcccacactgttgccgct
cagggtggcatcaacgccgcgctcggcaacatgcacaaggacgactggcgctggcacatg
tacgacaccgtcaagggctccgactggctcggtgaccaggacgctatccactacatgacg
cgcgaggccccggcttccattatcgagcttgagaactacggctgccccttctcgcgtacc
gacgagggcaagatctaccagcgtgctttcggtggccagtcccgcgagtacggcaagggt
ggccaggcctaccgttgctgcgccgctgccgatcgtaccggccatgccctgctgcacact
ctgtacggccagtctctgcgccacaacaccaactacttcatcgagtacttcgtcatcgac
ctgatcatggaggacggtgagtgccgcggtgtcctcgcctacaaccaggaggatggcacc
ctgcaccgcttccttgccaaccacaccgtcctcgccactggtggttacggccgcgcctac
ttctcgtgcacgtctgcccacacctgcacgggtgacggcatggccatggtggcccgtgcc
ggcctgcccaaccaggatctcgagttcgtccagttccaccctaccggtatctacggtgct
ggctgcctgatcaccgagggtgctcgtggtgagggtggttacctgctgaacagcgagggc
gagcgctttatggagcgttatgctcccactgccaaggatctggcctcgcgcgacgtcgtc
tcccgttccatgaccctcgagatccgcgagggccgtggtgttggccctgacaaggaccac
atctacctgcagctgagccatctgcccgccgaggtccttgccgagcgtctgcctggtatc
tcggagacggcgagcattttctcaggtgtggacgtccgcaagcagcccatccctgtcctg
cccaccgtccactacaacatgggtggtatccccaccaagtacactggtgaggtcctgacc
gtcgacgacaacggcaacgacaaggttgtgcccggcttgtacgcctgcggtgaggccgct
tgtgtgtctgtccacggtgccaaccgtctgggtgccaactccctgctggatctcgtcgtc
ttcggccgtgccgtctcccaccagatccgcgacacgtcgagccccggtgccaagctcaag
cccctgcgcgccgatgccgccgccgactccatcgagtacctcgacaagatccgtaacgcg
gacggcccgcgctcgacggccgagattcgcctggccatgcagaagaccatgcagacggat
gtcagcgtgttccgtacccaggagtccctggatgaaggtgtccgcaacatcaacaaggtc
gacaacaccttcagcgaagtcggcatcaaggaccgcagcatgatctggaactcggacctg
gtcgagacccttgagctccggaatctgctcacttgcgccacccaaaccgccaccgctgcc
gccaaccgcaaggagtcgcgtggtgcccacgcccgcgaggactaccccgaacgcgacgat
gccaactggatgaagcacaccctgaccttccagcgcgagccccacgggcccgtcgacctc
aagtaccgcaaggtcatcagcaccaccctggacgagaacgagtgcaagcccgtgccgccg
ttcaagcgtgtgtattaa

DBGET integrated database retrieval system