KEGG   Staphylococcus sciuri: CEP64_02765Help
Entry
CEP64_02765       CDS       T05176                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
sscu  Staphylococcus sciuri
Pathway
sscu00010  Glycolysis / Gluconeogenesis
sscu00053  Ascorbate and aldarate metabolism
sscu00071  Fatty acid degradation
sscu00280  Valine, leucine and isoleucine degradation
sscu00310  Lysine degradation
sscu00330  Arginine and proline metabolism
sscu00340  Histidine metabolism
sscu00380  Tryptophan metabolism
sscu00410  beta-Alanine metabolism
sscu00561  Glycerolipid metabolism
sscu00620  Pyruvate metabolism
sscu00625  Chloroalkane and chloroalkene degradation
sscu01100  Metabolic pathways
sscu01110  Biosynthesis of secondary metabolites
sscu01120  Microbial metabolism in diverse environments
sscu01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:sscu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CEP64_02765
   00053 Ascorbate and aldarate metabolism
    CEP64_02765
   00620 Pyruvate metabolism
    CEP64_02765
  09103 Lipid metabolism
   00071 Fatty acid degradation
    CEP64_02765
   00561 Glycerolipid metabolism
    CEP64_02765
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    CEP64_02765
   00310 Lysine degradation
    CEP64_02765
   00330 Arginine and proline metabolism
    CEP64_02765
   00340 Histidine metabolism
    CEP64_02765
   00380 Tryptophan metabolism
    CEP64_02765
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    CEP64_02765
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    CEP64_02765
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    CEP64_02765
Enzymes [BR:sscu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     CEP64_02765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ASE33559
UniProt: A0A3A0R9P8
LinkDB All DBs
Position
555342..556772
Genome map
AA seq 476 aa AA seqDB search
MRQDIKQYINGEWVESHSGKTLDVINPATEEVMGKIAAGNKQDVGDAVAAAKKVYVKFRN
TSLEERKALLERIADEYENRKEDLIDVMTDELGSPIEKSESVHYQMGLNHFREASKAIDS
IQFEERRGDDLVIKEAIGVSGLVTPWNFPTNQTSLKLAGAFAAGSPVVLKPSEETPFAAI
ILAEIFEKAGVPKGVFNLVNGDGQSVGDPLSSHPDVRMMSFTGSGPTGRKIMENSAKDFK
KVSLELGGKSPLVVLDDVDIEEAAKGAVAKFVQNTGQVCTAGTRTLVPESIKDEFIAAAK
KAIENVKVGNPREAGQDAGPVVSKKQFDTVQSYIQKGIDEGATLLHGGVGKPDGLEKGYF
VKPTLFTDVTNDMTIAQEEIFGPVGTIITYKDLDEAIEIANDTIYGLAAYVYGKDLERVR
EVAKALEAGTVEINDAGRKPNLPFGGYKQSGIGREWGDYGIEEFLEIKAIPGYFKE
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atgagacaagatatcaagcaatatataaatggcgaatgggttgaaagtcatagtggaaaa
acattagatgttataaaccctgctacagaagaagtaatgggtaaaattgctgcaggtaac
aaacaagatgttggtgacgctgtagctgccgctaaaaaagtgtacgtgaaatttagaaat
acttctttagaagaaagaaaagctttactagaaagaattgcagatgaatacgaaaataga
aaagaagatttaatagatgttatgacggatgagcttggctcaccaattgaaaaatcagaa
tctgttcattatcaaatgggcttaaaccattttagagaagcaagtaaagcgatcgattca
attcaatttgaagaacgtcgtggtgatgatttagttattaaagaagctatcggtgtttct
ggattagtaacaccatggaacttcccaactaaccaaacatcattaaaattagctggtgca
tttgctgcaggttcacctgtagtcttaaaaccatctgaagaaacaccatttgcagcaatt
attttagctgaaatatttgaaaaagctggcgtgcctaaaggtgtgttcaacttagtcaat
ggtgatggccaaagtgttggtgatccattaagttcacatcctgatgtacgtatgatgtca
tttacgggttctggcccaactggtagaaaaattatggaaaactctgctaaagacttcaaa
aaagtatcattagaactaggtggtaaatcaccattagtagtgttagatgatgtagatatc
gaagaagcagctaaaggtgcagttgctaaattcgtacaaaatactggtcaagtttgtact
gcaggtacacgtacattagtaccagaaagtattaaagatgaatttatcgcagcagctaaa
aaagcaattgaaaatgttaaagttggtaatcctagagaagctggccaagatgctggtcca
gttgtatctaaaaaacaatttgatacagttcaaagctatattcaaaaaggtatcgatgaa
ggtgcaacattattacatggtggtgttggtaaaccagacggccttgaaaaaggttacttc
gttaaaccaacattatttactgatgtaacaaatgatatgacaattgctcaagaagaaata
ttcggtccagtaggtacaattattacttataaagacttagatgaagcaattgaaattgct
aatgatacaatttatggtttagcagcatatgtatatggtaaagatttagaacgtgtaaga
gaagttgctaaagcattagaagcaggtactgtggaaattaatgatgcaggtagaaaacct
aatttaccattcggtggttataaacaatcaggtattggtagagaatggggcgactatgga
attgaagaattcttagaaattaaagcaattccaggttattttaaagaatag

DBGET integrated database retrieval system