KEGG   Staphylococcus sciuri: CEP64_02950Help
Entry
CEP64_02950       CDS       T05176                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
sscu  Staphylococcus sciuri
Pathway
sscu00473  D-Alanine metabolism
sscu00550  Peptidoglycan biosynthesis
sscu01100  Metabolic pathways
sscu01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:sscu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CEP64_02950
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CEP64_02950
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CEP64_02950
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sscu01011]
    CEP64_02950
Enzymes [BR:sscu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CEP64_02950
Peptidoglycan biosynthesis and degradation proteins [BR:sscu01011]
 Precursor biosynthesis
  Amino acid ligase
   CEP64_02950
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 ATP-grasp ATP-grasp_4 GARS_A
Motif
Other DBs
NCBI-ProteinID: ASE33594
UniProt: A0A1X0TTK7
LinkDB All DBs
Position
587162..588235
Genome map
AA seq 357 aa AA seqDB search
MSKKNICIIYGGKSAEHDVSILTAQNVINAVDLSKYIIDIIYITNDGDWIKSDQSIDGKV
EDVEQLKLTSETLTPISKLLEASNDGNAYSAVFPLLHGPNGEDGTIQGLFEVLDIPYVGN
GVLAASSSMDKLVMKHLFAHRGLPQLPYVSFLKSEYEKYERNIVELIQNKLEYPVFVKPA
NLGSSVGISKCTNKEELISGIEEAFQFDRKLVIEQGVDAREIEVAVLGNDYPETTLPGEV
VKDVQFYDYKSKYKDGKVKLQIPADVDEETATTLRNMAIEAFKATDCSGLVRADFFLTED
NTIYINETNAMPGFTQYSMYPLLWENMNLSYTELITKLIELAIERYDNKKNIKYKID
NT seq 1074 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaaaaaaatatttgcattatatatggtgggaaaagtgcagagcacgatgtatca
attttaacggctcaaaatgtgatcaatgcagttgatctatctaaatacataattgatatc
atttatattacaaatgatggggattggattaaaagcgaccaatctattgatggaaaagtc
gaagatgttgaacaattaaaattaacaagtgaaacattaacaccaatatctaaattatta
gaagcgagtaatgatggaaacgcatatagtgcagtatttcctttattacacggccctaac
ggagaagacggtacaattcaaggcttatttgaagtattggatattccttatgttggtaat
ggtgtgcttgcagcatcaagttcaatggataaattagttatgaaacatttattcgctcac
agaggattacctcaattaccatatgtaagtttcttaaaaagtgaatacgagaaatatgaa
cgtaatatagtggagcttattcaaaataaacttgaatatcctgttttcgttaaaccagca
aatttaggatcaagtgttggtattagtaaatgtacgaataaagaagaattaatttctggt
attgaagaagcatttcaatttgaccgtaaacttgttatcgaacaaggtgttgatgcaaga
gaaattgaagtagctgtattaggtaatgattatccagaaacaactttaccaggtgaagtt
gttaaagatgtacaattttatgattataaatctaaatataaagatggcaaagttaaactt
caaatacctgctgatgtagatgaagaaacagcaacaactttaagaaatatggctattgaa
gcttttaaagcaacagattgttctggattagtaagagcagacttcttcttaacagaagac
aatacaatttatattaacgaaacaaatgcaatgccaggatttacacaatacagcatgtat
ccattattatgggagaacatgaacttaagctatacagaacttataactaagttaattgaa
cttgctattgaacgatacgataacaagaagaatatcaaatataaaattgactga

DBGET integrated database retrieval system