KEGG   Staphylococcus sciuri: CEP64_03550Help
Entry
CEP64_03550       CDS       T05176                                 

Definition
(GenBank) Asp-tRNA(Asn)/Glu-tRNA(Gln) amidotransferase subunit GatB
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
sscu  Staphylococcus sciuri
Pathway
sscu00970  Aminoacyl-tRNA biosynthesis
sscu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sscu00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    CEP64_03550
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:sscu03029]
    CEP64_03550
Enzymes [BR:sscu01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     CEP64_03550
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     CEP64_03550
Mitochondrial biogenesis [BR:sscu03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    CEP64_03550
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey GFP
Motif
Other DBs
NCBI-ProteinID: ASE33706
LinkDB All DBs
Position
705069..706496
Genome map
AA seq 475 aa AA seqDB search
MHFETIIGLEVHVELKTESKMFSPSPAHFGAEPNTNTNVIDLAYPGVLPVVNKTAVDWAM
RAAMALNMDIAKESKFDRKNYFYPDNPKAYQISQFDQPIGENGWIDIEVDGETKRIGITR
LHMEEDAGKLTHKDGYSLVDLNRQGTPLIEIVSEPDIRSPKEAYAYLEKLRAIIQYTGVS
DCKMEEGSLRCDANISLRPYGQEEFGTKAELKNLNSFNYVRKGLEHEEKRQAEVLLAGGE
ILQETRRFNESTGETILMRVKEGSDDYRYFPEPDLVPLYVDDEWKERVRQTIPDLPDVRK
ERYVNELGLPSYDAHVLTLTKEMSDFFEAAIEHGADVKLTSNWLMGGVNEYLNKNQIELQ
DTALTPENLAGMIKLIEDGTMSSKIAKKVFPELAENGGDAHQIMKDKGLVQISDEATLLG
FVTEALDNNPQSVEDFKNGKGKAMGFLVGQIMKISKGQANPQIVNQLLKSELEKR
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgcattttgaaacaattatcggcttagaagttcacgtcgaattaaaaacagaatcaaaa
atgttttcaccatcacccgctcattttggtgcggaacctaatacaaatacaaacgttatt
gacttagcatacccaggcgtattaccagttgtaaacaagacagctgttgattgggctatg
cgtgcagcaatggcattaaatatggatattgcgaaagaatctaaatttgatagaaaaaac
tatttctacccagataatccaaaagcttatcaaatttctcaattcgatcaaccaattggt
gaaaatggttggattgatattgaagtagatggagaaactaaacgtattggtatcactcgt
ttacacatggaagaagatgcagggaaattaacacataaagatgggtattctttagttgat
ttaaaccgtcaaggaacaccattaattgaaatcgtttctgaacctgatattcgatctcct
aaagaagcgtatgcatacttagaaaaattacgtgcaattattcaatatacaggcgtatca
gattgtaaaatggaagaaggttcattacgttgtgatgccaacatttcattacgtccatat
ggtcaagaagaattcggtacaaaagcagagcttaaaaacttaaactcatttaactatgtc
cgtaaaggtcttgaacatgaagaaaaacgccaagcagaagtattattagctggtggagaa
attttacaagaaacacgtcgtttcaacgaatcaacaggcgaaacaattttaatgcgtgtt
aaagaaggttcagatgactatcgttacttcccagaaccagacttagtaccattatatgtt
gatgatgagtggaaagaacgtgtacgtcaaacaatcccagatttaccagacgtacgtaaa
gaacgttatgttaatgaattaggattaccatcttatgatgcacatgtattaacattaact
aaagaaatgtcagatttctttgaagcagcaattgaacatggtgcagacgttaaattaaca
tctaactggttaatgggtggcgttaatgaatacttaaataaaaatcaaatcgaattacaa
gatactgcattaacaccagaaaacttagcaggtatgattaaacttattgaagatggcaca
atgagtagtaaaattgctaagaaagtattccctgaattagctgaaaatggtggagacgca
catcaaattatgaaagacaaaggtcttgtacaaatatctgatgaagcaacactattagga
tttgttacagaagcattagataacaatccacaatcagtagaagactttaaaaatggtaaa
ggcaaagcgatgggcttcttagtaggtcaaattatgaaaatttcaaaaggccaagcaaac
ccacaaatcgtgaaccaattactaaaatcagaattagagaaaagataa

DBGET integrated database retrieval system