KEGG   Staphylococcus sciuri: CEP64_05540Help
Entry
CEP64_05540       CDS       T05176                                 

Definition
(GenBank) phosphate ABC transporter ATP-binding protein
  KO
K02036  phosphate transport system ATP-binding protein [EC:7.3.2.1]
Organism
sscu  Staphylococcus sciuri
Pathway
sscu02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:sscu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    CEP64_05540
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:sscu02000]
    CEP64_05540
Enzymes [BR:sscu01000]
 7. Translocases
  7.3  Catalysing the translocation of inorganic anions and their chelates
   7.3.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.3.2.1  ABC-type phosphate transporter
     CEP64_05540
Transporters [BR:sscu02000]
 ABC transporters, prokaryotic type
  Phosphate and amino acid transporters
   Phosphate transporter
    CEP64_05540
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ABC_tran SMC_N AAA_21 AAA_15 Rad17 AAA_29 RsgA_GTPase PRK AAA_23 AAA_22 RNA_helicase AAA_10 AAA_30 Adeno_IVa2 AAA_16 PhoH AAA_18 AAA AAA_28 ATPase_2 AAA_24 ATP_bind_1 AAA_14 Viral_helicase1 AAA_33
Motif
Other DBs
NCBI-ProteinID: ASE34055
LinkDB All DBs
Position
1087468..1088313
Genome map
AA seq 281 aa AA seqDB search
MTMTDVKIRDLSQNIPSNEMTANQQIAVEDKNIVYKTNNLDLWYGDFHALKNINLDITEN
EVTAIIGPSGCGKSTYIKTLNRMIELIPSVKTSGEIIYRDKNIFDKKYSVEELRTNVGMV
FQKPNPFPKSIYDNITYGPRIHGITDKKVLDEIVERSLKGAAIWDECKDRLDKNAYGLSG
GQQQRICIARCLAIEPDVILMDEPTSALDPISTLKVEELVQELKTKYSIIIVTHNMQQAA
RISDKTAFFLNGYVNEFDQTDKIFSNPTDKKTEDYISGRFG
NT seq 846 nt NT seq  +upstreamnt  +downstreamnt
atgactatgacagacgtaaaaattagagatctatctcaaaatataccttcaaatgaaatg
acagcaaatcaacaaatagcagtagaagataaaaatatcgtttataaaacgaataattta
gatttatggtatggagattttcatgcgcttaaaaatataaatttagatattacagaaaat
gaagtgactgcaattattggaccatctggttgtggtaaatcaacttatataaaaacatta
aatagaatgattgaattaattccaagtgttaaaacatctggagaaatcatttatagagat
aaaaacattttcgacaaaaaatatagtgttgaagaattaagaaccaatgttggtatggtt
ttccaaaaaccaaatccatttccaaaatcaatctatgacaacattacttatggaccaaga
attcatggtattacggataaaaaggtactagatgaaatcgttgaacgttcattaaaaggt
gcagctatttgggatgaatgtaaagatagactagataagaatgcatatggattatctggt
gggcaacagcaaagaatttgtatagcgagatgtttagcaattgaaccagatgttatttta
atggatgagccaacttcagcgctagatcctatttcaacactaaaagtagaagaacttgtg
caagaattaaaaactaaatactcaatcattatcgtgacacataacatgcaacaagcagct
agaatttctgataaaacagcgttcttcctaaacggttatgtaaatgagttcgatcaaaca
gataaaatattctctaacccaacagataagaaaactgaagactatatttcagggagattt
ggataa

DBGET integrated database retrieval system