KEGG   Staphylococcus schleiferi 2317-03: RN70_03785Help
Entry
RN70_03785        CDS       T04520                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
sscz  Staphylococcus schleiferi 2317-03
Pathway
sscz00240  Pyrimidine metabolism
sscz01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sscz00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    RN70_03785
Enzymes [BR:sscz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     RN70_03785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK
Motif
Other DBs
NCBI-ProteinID: AKS73100
LinkDB All DBs
Position
858750..859352
Genome map
AA seq 200 aa AA seqDB search
MYEAYHSGWIECITGSMFSGKSEELIRRLRRGVYAKQKVIVFKPAIDDRYHKEKVVSHNG
NEIEAINISKANEIWHYNLKDVDIIGIDEIQFFNQEIVEIAEKLAEKGYRVITAGLDMDF
RGEPFHPVPEMLAVSEHITKLQAVCAVCGASSSRTQRLIDGKPAKVDDPIILVGADERYE
PRCRAHHVVLPSEDTEEGQE
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgtatgaagcgtaccattcaggttggatagaatgtattaccggaagtatgtttagtggt
aagtcggaagaactgataagacgattacgcagaggtgtttacgccaagcaaaaagttatc
gtttttaaaccggccattgatgaccgctatcataaagaaaaagtggtatcacataatggt
aatgagatagaggcgattaatatttctaaagcaaatgaaatatggcattataatttaaaa
gatgtagacatcatcggtattgatgaaattcaattttttaatcaagaaattgtagagatt
gcagaaaaacttgcagaaaaaggttatagagtcattacagcaggacttgatatggatttt
agaggtgagccatttcatcctgttcctgaaatgcttgctgtaagtgaacatattacaaaa
ttacaagcagtatgtgccgtatgtggcgcttcatcaagtcggacacagcgattaattgat
ggtaagcctgcaaaagtggacgatccgattattttggttggcgcagacgaacgttacgaa
ccgcgttgtcgtgcgcatcatgttgtattaccgagcgaagatactgaggagggacaagaa
taa

DBGET integrated database retrieval system