KEGG   Staphylococcus schleiferi 2317-03: RN70_05920Help
Entry
RN70_05920        CDS       T04520                                 

Definition
(GenBank) acetyl-CoA carboxylase biotin carboxylase subunit
  KO
K01961  acetyl-CoA carboxylase, biotin carboxylase subunit [EC:6.4.1.2 6.3.4.14]
Organism
sscz  Staphylococcus schleiferi 2317-03
Pathway
sscz00061  Fatty acid biosynthesis
sscz00620  Pyruvate metabolism
sscz00640  Propanoate metabolism
sscz01100  Metabolic pathways
sscz01110  Biosynthesis of secondary metabolites
sscz01120  Microbial metabolism in diverse environments
sscz01130  Biosynthesis of antibiotics
sscz01200  Carbon metabolism
sscz01212  Fatty acid metabolism
Module
sscz_M00082  Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:sscz00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    RN70_05920
   00640 Propanoate metabolism
    RN70_05920
  09103 Lipid metabolism
   00061 Fatty acid biosynthesis
    RN70_05920
Enzymes [BR:sscz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     RN70_05920
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     RN70_05920
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CPSase_L_D2 Biotin_carb_N Biotin_carb_C Dala_Dala_lig_C ATP-grasp ATP-grasp_3 RimK ATPgrasp_ST GARS_A ATP-grasp_4 ATP-grasp_5
Motif
Other DBs
NCBI-ProteinID: AKS73463
LinkDB All DBs
Position
1284562..1285932
Genome map
AA seq 456 aa AA seqDB search
MYRVLVANRGEIAVRIIRALREMGMESVAIYAVGDEESLHVKLADDAVCIGQPNPLDSYL
HIHKILSAAEITNANAIHPGYGFLSESPVFAEKVESEGLYFIGPTNETMKLMGDKITARQ
TVDQAGVPVIPGSKSSVEDIEEIEKLAEDIGYPLVIKAASGGGGKGIRIVKDESQLERAF
KEAKSEGNKYFNDDRVYVEAFIPIAKHVEVQVLGDGQGQYIHLGERDCSVQRKNQKLIEE
SPCSALSDEKREKICNDAVKVAQAAHYRSAGTIEFLVTEDAYYFIEMNARIQVEHTVTEM
RTDIDLVRQQLLIMKNGQLDLKQEDITFKGHVIEARINAEDPEKGFRPTPGTVQRLHFPH
GFNIRVDSLLYGGYTVSSYYDSLVAKVIVKGESRQHAIEKLKVTLDELVIDGFKTTSDFL
YALLSYPPYFEGDAKEVDIKFLDRHNIFKEVTENEN
NT seq 1371 nt NT seq  +upstreamnt  +downstreamnt
atgtatcgtgtattagttgcaaatagaggagaaatagcggtccgcattattagagcgctt
agagaaatgggtatggagtctgtcgcgatttatgccgttggcgatgaggaaagtttgcat
gtgaaactcgctgatgatgcggtttgcatcggacaacctaatccacttgatagttatttg
catattcataaaatcttgtcagctgcagaaattacaaatgcaaatgccattcatccaggc
tatggcttcttatctgaaagcccagtttttgctgaaaaagtagaaagtgaaggcctctat
tttattggacctactaatgaaacgatgaaattgatgggagataaaattactgcgagacaa
accgttgaccaagcaggcgtgccagtaattcccggttcaaaatcatctgtagaagatatt
gaagaaattgaaaaacttgcagaagatatcggttatccacttgttattaaagcggcaagt
ggtggcggtggtaaaggcattcgcattgttaaagacgaatctcaattagaacgcgcattt
aaagaggccaaaagcgaaggaaataaatattttaacgatgatcgtgtttatgttgaggca
tttatccctatagcaaaacatgttgaagttcaagttttgggtgacggacaaggacaatat
atccatttaggtgagagagactgctctgtacaaagaaaaaatcaaaaacttattgaagaa
tcgccatgtagcgctttaagtgatgaaaaaagagaaaagatttgtaatgatgctgtcaaa
gtggctcaagcagctcactatagaagtgcaggaacgattgaatttcttgttacagaagac
gcttattactttattgaaatgaatgcacgtattcaagttgagcatacagtgactgaaatg
cgtacggatatcgatcttgttcgtcaacaattattaataatgaagaacggtcaactcgat
ttaaaacaggaagatattacgtttaaaggccatgtcatagaagcaagaattaacgcggaa
gaccctgaaaaagggttccgtccaacaccgggcacagttcaacgacttcatttccctcat
ggcttcaatatacgcgttgactcacttttatacggcggttatactgtatcttcatattat
gattcacttgtagctaaagttatcgtcaaaggggaatctagacaacatgcgattgaaaaa
ttaaaagtgacattagatgaactcgttatagatggctttaaaacgacttcagacttcttg
tatgcattactttcatatccgccatattttgaaggtgatgcaaaagaagtagatattaaa
tttttagatcgtcacaacatttttaaggaggtcactgaaaatgaaaattga

DBGET integrated database retrieval system