KEGG   Staphylococcus schleiferi 2317-03: RN70_08225Help
Entry
RN70_08225        CDS       T04520                                 

Definition
(GenBank) serine/threonine protein kinase
  KO
K12132  eukaryotic-like serine/threonine-protein kinase [EC:2.7.11.1]
Organism
sscz  Staphylococcus schleiferi 2317-03
Brite
KEGG Orthology (KO) [BR:sscz00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:sscz01001]
    RN70_08225
Enzymes [BR:sscz01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     RN70_08225
Protein kinases [BR:sscz01001]
 Serine/threonine kinases: Other
  Bacterial family
   RN70_08225
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pkinase Pkinase_Tyr PASTA APH Pkinase_fungal RIO1 Seadorna_VP7 FTA2 Zn_peptidase_2 Kinase-like Kdo
Motif
Other DBs
NCBI-ProteinID: AKS73884
LinkDB All DBs
Position
complement(1742280..1744307)
Genome map
AA seq 675 aa AA seqDB search
MIGRLIDDRYELTQILGGGGMSNVYVAMDTILNRKVAVKLIHILPNEKQATVQRFEREVQ
NTTRLSHKNIVSVLDVGEEDDCFFLVMEYIEGPTLSDYIKAHGPLQPQKALQFMDQILSG
IRHAHEQGIIHRDIKPQNMIIDRNQTLKIVDFGIAKALSETAMTQTNHVVGTVQYLSPEQ
AKGEKTGERSDIYSLGIVLYEMLTGQPPFNGETPVSIAIKQIQETVPNVSDKRRDVPQAL
SNVILKATEKEQSNRYRSVSEMASDVMSTLDPSRKNEPLYESDTSKTKTVPIDKNALKIE
QDKQNKSVKETTQIPIVQTEKQAEPKQSKKASYYVPTQKRSVRKKVVFGFILVLLVASLF
VFMAAAMIGNKYSQVPDVLGKSEQQTEKLLKDNKLKIGHISHEYSDHYDKERVMAIKPEA
GSKVEQNSQVDIIISKGQHIEKMPNLIGMTKRDAENKLKSLGFSHVTFTTAYTQNDIEKG
SIEAQSITPGENVVVTKDAVQITESLGKRQIYVDDYTNQDYDKVKQELEEKGLNVEIEKE
RADHHVKENHIINHTPKKTNVDEGDTVRFIISIGKEEDDNNSEDKADRDSKTVREKPYSE
NVTIPYSGKNKKAQKVEVYIQDKNNDSDSPAETFTISKSISYPLNLTIPKDDSGHYEIKV
DGKTVDRKTIHYDDL
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgatagggcgtttgatagatgatcgctatgaattaacccaaattcttggcggcggtggt
atgtcgaatgtctacgttgcaatggacaccattttaaatcgtaaagtggcagtcaagttg
attcatattttgccgaatgaaaaacaagcaacagtgcaacgctttgaaagagaagtgcaa
aatacgacacggttatcacataaaaatattgtgagcgtacttgatgttggtgaagaagat
gattgtttctttttagtgatggaatatattgagggaccgactttatcagattatataaaa
gcacacggccccttacagccacaaaaagcactacaatttatggaccaaattttaagtggt
atccgtcatgcacatgaacaagggattatccatcgggatattaagccgcaaaatatgatt
attgatcgtaatcaaacattaaaaattgtagattttggaatcgccaaagcgttaagtgaa
acagcgatgacacagacgaatcatgtggtcggaacagtgcaatatctttcgccagaacaa
gcaaaaggtgagaaaaccggagagcgctctgatatttattctttaggtatcgttttgtat
gaaatgttaactgggcaaccgccatttaatggtgaaacgcctgttagtattgcgattaag
cagatacaagagacagtccctaatgtaagtgataaaagaagagatgttccgcaagcatta
agtaatgtcattttaaaagcgacagaaaaagagcaaagtaatagatatcgctctgtctca
gagatggcgagtgatgtcatgtctacactagatcctagtcgtaaaaatgaacccctttat
gaatcggatacatctaaaacgaaaacagtgcctattgataaaaatgcgctaaagatagaa
caagataaacaaaataaatctgtaaaagaaacaacacaaattccaatcgttcaaactgaa
aaacaagctgaacctaaacagtctaagaaggcctcttattatgtgccaacacagaaacgc
tctgtccgcaaaaaagtggtctttggttttatcctagtcctgttagtcgcaagtttgttt
gtttttatggctgcagctatgattggcaataaatatagccaagtccctgatgtacttggt
aaatcagaacaacaaaccgaaaagttattaaaagataacaagcttaaaattggccacatt
tcacatgaatatagtgaccattatgataaagaacgtgttatggcgattaaacctgaagct
ggttcaaaagtagaacaaaacagtcaggttgatattattatttctaaaggccaacatatt
gagaaaatgccgaatctcattggtatgactaaacgtgatgctgaaaataaattgaagtca
ttaggctttagtcatgtgacttttacaactgcatacacacaaaacgatattgaaaaagga
agcatagaagcacaaagtattacaccaggggaaaatgttgtcgttactaaagatgcagta
cagattactgagtcacttggaaagcgacaaatctatgtcgatgattacacaaatcaagat
tatgataaggtcaaacaagagttggaagaaaaaggtttaaatgttgaaatagaaaaagag
cgtgcagatcatcatgtgaaagaaaatcatatcattaaccacacccctaaaaagacgaac
gtcgatgaaggagacactgtaagatttatcatctctatcggcaaagaagaagatgataat
aacagtgaggataaagcagatcgtgattctaaaactgtgcgggagaaaccttattctgaa
aatgtgacaattccatatagtggcaaaaacaaaaaagcgcaaaaagtagaagtgtatatc
caagataaaaataatgatagtgattcaccggctgaaactttcactatttccaaaagcatt
tcttatcctttaaatttaacaatacccaaagatgattcaggtcattatgaaattaaagta
gatgggaaaacggttgacagaaaaacaattcattacgatgatttataa

DBGET integrated database retrieval system