KEGG   Staphylococcus schleiferi 2317-03: RN70_09585Help
Entry
RN70_09585        CDS       T04520                                 

Definition
(GenBank) HAD family hydrolase
Organism
sscz  Staphylococcus schleiferi 2317-03
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hydrolase_6 Hydrolase_like HAD_2 Hydrolase DeoRC SBP_bac_6
Motif
Other DBs
NCBI-ProteinID: AKS74134
LinkDB All DBs
Position
complement(2047642..2048427)
Genome map
AA seq 261 aa AA seqDB search
MKAYKGYLIDLDGTMYKGSQKIEGAAEFIDYLNQNDIPHIYVTNNSTKAPVDVVDKLASF
DISAQPQEVVTSAMATADYISGEHPGATVYMLGGTGLATALEESGLQLKDDIHVDYVVIG
LDEAVNYEKLTKATLAVQNGATFISTNPDPSIPKEQGFLPGNGSITSVVTVSSKQTPIFI
GKPETPIMEKALEMLQLDKSEVAMIGDLYDTDIMSGIHVGMDTIHVQTGVTSKEEAMNRE
TPPTYSVKDLNELRENLIKSE
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcttataaaggctatttaatcgacttagacggaacaatgtataaaggcagccaa
aaaattgaaggtgctgcggaatttattgattatttgaatcaaaatgatattccgcatatt
tatgtgacgaataattctacaaaagcacctgtagatgttgtcgataagttagcgagtttt
gatatttcagctcaaccacaagaagttgtgacctctgcaatggcgactgcggattatatt
agtggagaacatccaggcgctacagtgtatatgctaggtggaacaggcttagcaacggct
ttagaggagagtggacttcaattgaaagatgatattcatgtggactacgtggttatcggt
ttagatgaagcggtcaattatgaaaaattaaccaaagcgacattagctgttcaaaatggt
gcaacattcatttcaactaacccagacccgtctatccctaaagaacaaggttttttgccg
ggaaatggttcgattacaagtgtggtgactgtctcctctaaacagacaccgattttcatt
gggaaacctgaaacgcctataatggaaaaagcacttgaaatgttgcaattagataaaagt
gaagtggccatgattggcgatctttatgatacagacattatgtcaggcattcatgtaggt
atggacaccattcacgtccaaacaggtgtaacttcaaaagaagaggcaatgaatcgagaa
acaccgcctacatatagtgtgaaagatttaaatgaattgcgtgaaaatcttataaaaagc
gagtga

DBGET integrated database retrieval system