KEGG   Staphylococcus schleiferi 2317-03: RN70_12080Help
Entry
RN70_12080        CDS       T04520                                 

Definition
(GenBank) NADH dehydrogenase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sscz  Staphylococcus schleiferi 2317-03
Brite
KEGG Orthology (KO) [BR:sscz00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    RN70_12080
Enzymes [BR:sscz01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     RN70_12080
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 FAD_oxidored DAO AlaDh_PNT_C NAD_binding_8 K_oxygenase Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: AKS74571
LinkDB All DBs
Position
2538037..2539560
Genome map
AA seq 507 aa AA seqDB search
MLNQELKQQLSQLLDLMEGDVVLKASTASDENSQKVDNLVNEVAEMSSRITVEKADLKRT
PSFSINRPGEDTGITFAGVPLGHEFNSFVLALLQVSGRAPKEEQSVIDQIKSIEQPLHFE
TYISLTCHKCPDVVQALNLMSVLNPNITHTMIDGAVFKEEAEDIMAVPAIFLNGEQFGNG
RMTVTDILSTLGQGPDASAFENKEVFDVLVIGGGPASASSAIYAARKGLTTGIVADRIGG
QVNDTADIENLIGVKKTTGPSLSTNLEEHIKDYNIDVMKGVRAEQLEKTDKTVSVTLDNG
AVLETRSLIIGTGARWRKIGVPGEEKYTNKGVAYCPHCDGPLFEGKDVAVIGGGNSGIEA
AIDLAGICKNVTVLEFSDTLKADSVLQERLKSLPNTQVITNAATKEITGDDRVNGLTYTD
MQSKEDKHIDLDGVFVQIGLSPNTEWLGDSVQRNRMGEIEVDRLGNTNVPGVFAAGDCTD
QRYKQIIISMGSGATAALSAFDYLIRN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatcaagaattgaagcaacaattatcacaacttcttgatttgatggaaggtgac
gttgtacttaaagcaagtacagcttctgacgaaaattcacaaaaagtcgataaccttgtg
aatgaagtcgcagaaatgtcatctcgaattacagtagaaaaagctgatttaaagcgtaca
cctagctttagtatcaatagacctggagaggacactggcatcacattcgctggtgtccct
cttggtcatgaattcaactctttcgttcttgcacttttacaagtcagtggacgtgctccg
aaagaagaacaatctgtaattgatcaaatcaaatctattgaacaaccacttcactttgaa
acttatatcagcttaacttgtcataaatgtccagatgttgttcaagcattaaacttaatg
agtgtattgaaccctaatattacacacactatgattgatggtgctgtatttaaagaagaa
gcagaagacatcatggctgtacctgccatcttcttaaatggtgaacaattcggtaatggc
cgtatgactgtaacagatattttgagtacactcggtcaaggaccggacgcatctgcattt
gaaaacaaagaagtcttcgatgtacttgttattggtggcggtcctgcaagtgcaagttca
gcaatctatgctgcacgtaaagggctcacaacaggtattgtcgctgatagaattggtggc
caagtcaacgatacagcagatattgaaaacttaatcggtgttaagaaaacaacgggtcca
tcattatcaactaacttagaagaacatattaaagactacaatatcgatgttatgaaaggt
gttcgtgcagaacaacttgaaaaaacagacaaaactgtatcagtaacacttgataacggt
gctgttctagaaacacgttcattaatcatcggtacaggtgcacgctggagaaaaattggg
gtaccaggtgaagaaaaatacacgaacaaaggtgtcgcatactgcccgcactgtgacggc
cctctatttgaaggtaaagatgttgcagttatcggtggcggaaactctggtattgaagct
gctattgacttagcgggaatttgtaaaaatgtcacagtattagaattctctgacacgtta
aaagcagactctgtcttacaagagcgtttgaaatcattaccaaacacacaagttattact
aatgcagctacgaaagaaattacaggtgatgatcgtgtaaacggtctgacttatacagat
atgcaatcaaaagaagacaaacacatcgacttagatggcgttttcgttcaaatcggttta
tctcctaatacagaatggttaggcgactctgttcaacgtaaccgtatgggcgaaattgaa
gttgatcgtcttggtaatacaaatgtaccaggtgtcttcgcagctggggattgcacagac
caacgttacaaacaaattattatttcaatgggatcaggcgcaacagctgcattgtcagca
tttgactatctcatcagaaactaa

DBGET integrated database retrieval system