KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_0047Help
Entry
SPSINT_0047       CDS       T01396                                 

Definition
(GenBank) Alkyl hydroperoxide reductase protein F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Brite
KEGG Orthology (KO) [BR:ssd00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    SPSINT_0047
Enzymes [BR:ssd01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     SPSINT_0047
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox HI0933_like FAD_binding_2 Thioredoxin_3 GIDA DAO FAD_oxidored Thi4 NAD_binding_8 AlaDh_PNT_C FAD_binding_3 K_oxygenase Glutaredoxin
Motif
Other DBs
NCBI-ProteinID: ADV04576
LinkDB All DBs
Position
complement(45102..46625)
Genome map
AA seq 507 aa AA seqDB search
MLNQELKQQLSQLLDLMEGDVVLKVSTGDDDHSQKMNDLVNEVSDMSSRITVEKAELKRT
PSFSINRPNEDTGITFAGVPLGHEFNSFVLALLQVSGRAPKEEQSVIDQIKSIDEPLHFE
TFISLTCQKCPDVVQALNLMSVINPNITHTMIDGAVFKKEAEDIMAVPAIFLNGEQFGNG
RMTVTDILSELGQGPDASEFENKETFDVLVVGGGPASASSAIYAARKGLKTGIVADRIGG
QVNDTADIENLIGVKKTTGPSLATSLEEHIKDYNVDIMTGVRAEGLEKTDDIVHLTLDNG
AVLKTRSLIIATGARWKKIGVPGEDTFANKGVAYCPHCDGPLFEGKDVAVIGGGNSGVEA
AIDLAGICKSVTVLEYGESLKADSVLQERLNSLPNTTVITHAATQEIKGDDRVSGIAYTC
NETNQEKHVDLNGVFVQIGLSPNTEWLGDTVQRNRMGEIEVDRLGNTNIPGVFAAGDCTD
QRYKQIIISMGSGATAALSAFDYLIRN
NT seq 1524 nt NT seq  +upstreamnt  +downstreamnt
atgttaaatcaagaattaaagcaacaactttcacaacttcttgatttgatggaaggtgac
gttgttctgaaagtgagcactggcgatgacgatcattctcaaaaaatgaacgatctcgtt
aatgaagtttcagacatgtcatctcgaattacagtagaaaaagctgaattaaagcgtacg
cctagctttagtatcaacagaccaaacgaggacactggcattacatttgctggtgtccct
cttggtcatgagttcaattcttttgtccttgcactcttacaagtgagtggtcgtgcacca
aaagaagagcaatctgtaattgatcaaatcaagtctattgatgaaccccttcactttgaa
acattcattagcttaacatgtcaaaaatgtcctgatgtcgttcaagcattaaacttaatg
agtgtcatcaatccgaatataacacatacaatgattgatggtgccgttttcaaaaaagaa
gcagaagacattatggcggtacctgcaattttcttaaatggtgaacaattcggtaatggc
cgtatgacagtgacagacatacttagtgaattaggtcaaggtcctgacgcttctgaattt
gaaaataaagaaacatttgacgtcctcgtagtcggcggcggtcctgcaagtgcaagctct
gccatctatgctgcgcgtaaaggtttaaaaacaggtatcgtagcagacagaattggtggt
caagttaatgacacagctgatattgaaaacttaattggcgtgaagaaaacgacaggtcca
tcacttgcgacaagtcttgaagaacacattaaagactacaatgtggatattatgaccggc
gtacgtgcagaaggattagaaaaaacagatgatatcgttcatttgactttagataatggc
gcagtgcttaaaacgcgctcactcattatcgcaacaggtgcacgttggaagaaaatcggt
gtaccgggtgaagacacattcgcaaacaaaggtgttgcatactgcccgcactgtgacgga
cctctatttgaaggtaaagacgtcgctgttatcggtggcggtaactctggtgttgaagcc
gcgattgacttagcaggtatttgtaaaagtgtgacagtccttgaatatggtgagtcatta
aaagcagactctgtattacaagagcgtttaaattcattaccaaatacaacagtcatcaca
catgcagcaacacaagaaatcaaaggtgacgaccgcgtgagtggtattgcttacacttgt
aacgaaacaaatcaagaaaaacatgttgatttaaatggtgtcttcgttcaaatcggtctt
tctcctaatactgaatggttaggcgatactgttcaacgtaaccgcatgggtgaaattgaa
gtcgaccgtttaggaaacacgaacattcctggtgtctttgcggcaggcgactgtacagac
caacgctataaacaaatcattatttctatggggtcaggcgcaacagcagcattatctgca
ttcgactacttgattcgtaactaa

DBGET integrated database retrieval system