KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_0849Help
Entry
SPSINT_0849       CDS       T01396                                 

Definition
(GenBank) Succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
ssd00020  Citrate cycle (TCA cycle)
ssd00190  Oxidative phosphorylation
ssd00650  Butanoate metabolism
ssd01100  Metabolic pathways
ssd01110  Biosynthesis of secondary metabolites
ssd01120  Microbial metabolism in diverse environments
ssd01130  Biosynthesis of antibiotics
ssd01200  Carbon metabolism
Module
ssd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ssd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ssd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPSINT_0849
   00650 Butanoate metabolism
    SPSINT_0849
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SPSINT_0849
Enzymes [BR:ssd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SPSINT_0849
    1.3.5.4  fumarate reductase (quinol)
     SPSINT_0849
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 HI0933_like GIDA FAD_oxidored AlaDh_PNT_C NAD_binding_8
Motif
Other DBs
NCBI-ProteinID: ADV05377
LinkDB All DBs
Position
894000..895766
Genome map
AA seq 588 aa AA seqDB search
MAEKKIIVVGGGLAGLMSTIKAAEQGAHVDLFSIVPVKRSHSVCAQGGINGAVNTKGEGD
SPWVHFDDTVYGGDFLADQPPVKAMTEAAPQIIHLLDRMGVMFNRTAEGLIDFRRFGGTL
HHRTAFAGATTGQQLLYALDEQVRSYEVDGLVTKYEGWEFLGIVKDDENAARGIVAQNIT
TSEIQSFGSDAVIMATGGPGIIFGKTTNSMINTGSAASIVYQQGVKYGNGEFIQIHPTAI
PGDDKLRLMSESARGEGGRIWTYKDGKPWYFLEEKYPDYGNLVPRDIATREIFDVCVNQK
LGINGENMVYLDLSHKDPHELDVKLGGIIEIYEKFTGDDPRKVPMKIFPAVHYSMGGLYV
DYDQMTNIDGLFAAGECDFSQHGGNRLGANSLLSAIYGGTVAGPNAVKYVENIEKSYVDM
DDSMYQKRVDEEQARFDKLLNMKGSENAYKLHRELGEIMTANVTVVRHNDKLLETDKKIV
ELMKRYQDIDMEDTSQWSNQAVFFTRQLWNMLVLARVITIGAYNRNESRGAHYKPEFPER
NDDEWLKHTLAEYKGPDAPPAFTYKPVDVSLIPPRKRDYTSKSKGGKK
NT seq 1767 nt NT seq  +upstreamnt  +downstreamnt
atggcagagaagaaaattattgttgtcggaggcggtcttgccggtttaatgtcaacaatt
aaagcagcggagcaaggggcacatgttgatttgttctcaattgttccagtaaaacgctct
cactcagtatgtgcacagggcggtattaacggagcggtaaatacaaaaggtgaaggtgac
tctccgtgggttcattttgatgacactgtttacggtggggacttcttagcggatcaaccg
cctgttaaagcaatgactgaagcagcaccacaaatcatccatttattagaccgcatgggt
gtcatgtttaaccgtacagctgaaggacttatcgatttccgtcgtttcggtggaacatta
catcacagaactgcattcgctggtgcgacaacaggtcaacaattattatatgcattagat
gaacaagtgcgtagttatgaagtggatggacttgtgaccaaatatgaaggatgggaattt
ttaggtatcgttaaagatgatgaaaatgcggcgcgtggtattgttgcgcaaaacatcaca
acttctgaaattcaatctttcggttctgatgcagtgattatggcaactggtggtccaggt
attatttttggtaaaacgacaaactctatgatcaatacaggatcagctgcgtctatcgta
tatcaacaaggggtaaaatatggtaacggtgagtttatccaaattcacccaacagcaatt
cctggtgacgataaattacgtttaatgagtgaatcagcacgtggtgaaggtggccgtatt
tggacgtataaagacggtaagccttggtatttcttagaagagaagtatcctgattatggt
aacctcgttcctcgtgatattgcgacacgagaaattttcgatgtttgtgtgaatcaaaag
ctcggtattaacggtgaaaacatggtataccttgacttatcacacaaagatccacatgaa
ttagatgtaaaattagggggtatcatcgaaatttacgaaaaattcacaggtgacgatcca
cgtaaagtaccaatgaaaatcttcccagcagtacactactcaatgggtggtctttatgta
gattatgatcaaatgacgaacattgatggtttatttgcggcaggggaatgtgatttctca
caacatgggggtaaccgtttaggtgccaactcattattatcagctatttatggtggtact
gttgcaggacctaatgctgtgaaatatgtagaaaacattgaaaaatcttacgttgacatg
gatgatagcatgtatcaaaaacgtgtggatgaagaacaagcacgttttgacaagttgtta
aacatgaaaggttctgaaaatgcatataaattgcatcgtgaacttggtgaaattatgact
gcgaatgtgacggttgttcgtcataatgacaaattgttagaaactgacaagaaaattgtt
gaattgatgaaacgttaccaagatattgatatggaagatacatcgcaatggagtaaccaa
gctgtattcttcacacgtcaattgtggaacatgcttgtgttggcgcgcgtaatcacaatc
ggtgcttataatcgtaatgaatctcgtggtgcgcactataaaccggaattcccagaaaga
aatgacgatgagtggttaaaacacacattagctgaatataaagggccagatgcaccacca
gcatttacgtacaaacctgttgatgtcagcttaatcccacctcgtaaacgtgactacaca
agtaagtcaaaagggggtaaaaaataa

DBGET integrated database retrieval system