KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_0850Help
Entry
SPSINT_0850       CDS       T01396                                 

Definition
(GenBank) Succinate dehydrogenase iron-sulfur protein
  KO
K00240  succinate dehydrogenase / fumarate reductase, iron-sulfur subunit [EC:1.3.5.1 1.3.5.4]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
ssd00020  Citrate cycle (TCA cycle)
ssd00190  Oxidative phosphorylation
ssd00650  Butanoate metabolism
ssd01100  Metabolic pathways
ssd01110  Biosynthesis of secondary metabolites
ssd01120  Microbial metabolism in diverse environments
ssd01130  Biosynthesis of antibiotics
ssd01200  Carbon metabolism
Module
ssd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ssd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ssd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SPSINT_0850
   00650 Butanoate metabolism
    SPSINT_0850
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SPSINT_0850
Enzymes [BR:ssd01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SPSINT_0850
    1.3.5.4  fumarate reductase (quinol)
     SPSINT_0850
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fer2_3 Fer4_8 Fer4_10 Fer4_7 Fer4_9 Fer4_17 Fer4_16 Fer4_2 Fer4 Fer4_15 Fer4_13 Fer4_21 Fer4_18 Fer4_6 Fer4_4 Fer4_3
Motif
Other DBs
NCBI-ProteinID: ADV05378
LinkDB All DBs
Position
895766..896581
Genome map
AA seq 271 aa AA seqDB search
MAETQEKQQTSQQVQNSTSNKTIKLIIKRQKDQNSSPYEESFEIPYRENMNVIAALMEIR
RNPINTKGEKTTPVTWDMNCLEEVCGACSMVINGKARQSCSAIIDQLEQPIRLEPMTTFP
VIRDLQVDRTRMFDNLKRMKAWVPIDGTYDLGPGPRMPEKKRQTAYELSKCMTCGVCLEV
CPNVTKTNSFVGAQAISQVRLFNLHPTGAMTKDERLDALMDQGGLQACGNSQNCVQACPK
GIPLTTSIAAMNRETSFHMFKSFFGSDHEVE
NT seq 816 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaacacaagagaaacaacaaacatcacaacaagttcaaaatagcacttcaaat
aaaacaattaagttaattattaaacgacaaaaggatcaaaattcatcaccatatgaagaa
tcttttgaaattccttatcgtgaaaatatgaatgtcatcgcagcattaatggaaattcgt
cgtaacccgatcaatacaaaaggtgaaaaaacaacaccggtaacatgggatatgaactgt
ttagaagaggtctgtggtgcatgttcaatggtcattaatggtaaagcccgtcaatcatgt
tcagcgattatcgatcaattagaacaaccgattcgtcttgaaccgatgacgacattccca
gtcattcgcgacttacaagtagatcgtacgcgtatgtttgacaacttgaaacgtatgaaa
gcatgggtgccgattgatggtacgtatgacttaggtcctggtccacgtatgccagaaaaa
aaacgtcaaacagcttacgaattatcaaaatgtatgacatgtggggtatgtttagaagta
tgtccaaacgtcacaaaaaccaatagtttcgtcggtgctcaagccatttctcaagtgcgt
ttgtttaacttacatccgactggtgcaatgacaaaagacgaacgtttagatgcgttaatg
gatcaaggtggtttacaagcttgtggtaactcacaaaattgtgtgcaagcttgtccgaaa
ggtattccgttgacaacttctattgcagcgatgaaccgtgaaacatcattccatatgttc
aaatcattctttggttctgatcatgaagtagaataa

DBGET integrated database retrieval system