KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_1150Help
Entry
SPSINT_1150       CDS       T01396                                 

Definition
(GenBank) hypothetical protein
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: YpsA
Motif
Other DBs
NCBI-ProteinID: ADV05678
LinkDB All DBs
Position
complement(1221601..1222158)
Genome map
AA seq 185 aa AA seqDB search
MFKAMYFTGYKSYELQIFNEHAPEVTYLKKFITQKLIQYIDQGLEWVLIQGQLGIELWSA
ECVIALKEDYPELKLGVITPFLEHTSKWNEQNQLKYQQIIEKSDYVNSVHQHTYEGPFQF
EQADQFMLDHTDITVLIYDEEQPASPQFFKKKLVDFVEKTNYTCDIVTFDEMTNFINDLQ
WSEEI
NT seq 558 nt NT seq  +upstreamnt  +downstreamnt
atgtttaaggcaatgtatttcacaggttacaagtcttacgaactgcaaatattcaatgaa
catgcacctgaagtgacctatttaaaaaaatttataacgcaaaaattaattcagtatata
gatcaaggtttagaatgggtgttaatccaagggcaattgggtattgaattatggagtgcc
gagtgtgtcattgcgttgaaagaagattatcccgagctaaaattaggcgtcattacacca
tttttagaacacacatctaaatggaatgagcaaaatcagctcaaatatcaacagataatc
gaaaagagtgattatgtcaacagtgtgcatcagcatacatacgaaggaccgtttcagttt
gaacaagcggatcaatttatgttggaccatacggatatcactgtactaatttatgatgaa
gaacaacccgcaagcccacaatttttcaaaaagaagttagttgattttgttgaaaaaaca
aactatacttgtgatattgtgacgtttgacgaaatgacgaactttatcaatgatttacaa
tggtccgaagaaatttaa

DBGET integrated database retrieval system