KEGG   Staphylococcus pseudintermedius HKU10-03: SPSINT_1785Help
Entry
SPSINT_1785       CDS       T01396                                 

Definition
(GenBank) Aldehyde dehydrogenase
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
ssd  Staphylococcus pseudintermedius HKU10-03
Pathway
ssd00010  Glycolysis / Gluconeogenesis
ssd00053  Ascorbate and aldarate metabolism
ssd00071  Fatty acid degradation
ssd00280  Valine, leucine and isoleucine degradation
ssd00310  Lysine degradation
ssd00330  Arginine and proline metabolism
ssd00340  Histidine metabolism
ssd00380  Tryptophan metabolism
ssd00410  beta-Alanine metabolism
ssd00561  Glycerolipid metabolism
ssd00620  Pyruvate metabolism
ssd00625  Chloroalkane and chloroalkene degradation
ssd01100  Metabolic pathways
ssd01110  Biosynthesis of secondary metabolites
ssd01120  Microbial metabolism in diverse environments
ssd01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ssd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SPSINT_1785
   00053 Ascorbate and aldarate metabolism
    SPSINT_1785
   00620 Pyruvate metabolism
    SPSINT_1785
  09103 Lipid metabolism
   00071 Fatty acid degradation
    SPSINT_1785
   00561 Glycerolipid metabolism
    SPSINT_1785
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    SPSINT_1785
   00310 Lysine degradation
    SPSINT_1785
   00330 Arginine and proline metabolism
    SPSINT_1785
   00340 Histidine metabolism
    SPSINT_1785
   00380 Tryptophan metabolism
    SPSINT_1785
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    SPSINT_1785
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    SPSINT_1785
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    SPSINT_1785
Enzymes [BR:ssd01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     SPSINT_1785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh VASP_tetra
Motif
Other DBs
NCBI-ProteinID: ADV06313
LinkDB All DBs
Position
complement(1859075..1860508)
Genome map
AA seq 477 aa AA seqDB search
MRDQTKQYINGEWVESHSGETIAVINPATEEVFGHIAKGNKADVDQAVQAAHDVYLSFRN
SSVKERQDLLDRIVKEYENRKDDLIEAMTLELGAPVTQSEKVHYQMGLNHFKAARDALND
FQFEERRGDNLIVKEAIGVAGLVTPWNFPTNQTSLKLAAAFAAGSPVVLKPSELTPYAAI
ILAEIFDKVGVPKGVFNLVNGDGEGVGTPLTQHPDVRMVSFTGSGGTGSKIMEAASKDFK
KVSLELGGKSPFIILDDANLEEAAKAAVKKVVNNTGQVCTAGTRTLVPESIKDDFLKEVK
KQMANVKVGDPQNTETQMGPIVSEKQYNQVQDYIQKGIDEGAELLYGGTGKPDGLDKGYF
AKPTIFTNVNNQMTIAQEEIFGPVMSIITYKDLDEAIEIANDTKYGLAGYVFGQNKENLI
RVARSIEAGTIEINEAGRASDLPFGGYKQSGIGREWGDFGIEEFLEVKSIAGYYKGE
NT seq 1434 nt NT seq  +upstreamnt  +downstreamnt
atgagagatcaaacaaaacaatatattaatggtgaatgggttgaaagtcatagcggtgaa
acgatagcagtcattaacccagccacagaagaagtatttggtcatatcgcaaaagggaat
aaagcagatgtagaccaagcagttcaagctgctcatgacgtgtatctttcatttcgtaac
tcgtctgtcaaagaacgacaagacttgttagatcgtattgttaaagaatatgaaaatcgt
aaagatgatttaatagaagcaatgacattagagctaggtgcacctgtgacacaatcagaa
aaagtgcattatcaaatgggcttaaaccattttaaagctgcacgtgacgcattgaatgat
ttccaatttgaagaacgtcgcggagataacttaatcgtgaaagaagcaattggtgttgca
ggacttgtcacaccttggaacttcccaacgaaccaaacatcacttaaattagcggcagca
tttgcggcaggaagtccggttgtcctcaaaccatctgaattgacgccatatgcagcgatt
attttagctgaaattttcgataaagttggtgtacccaaaggtgtatttaaccttgtcaat
ggcgatggtgaaggtgtcggtacaccgttaactcaacatcctgatgtccgcatggtgtca
tttacaggttctggtggcacaggttcaaaaattatggaagcggcgagcaaagacttcaaa
aaagtatcattggaactcggtgggaaatctccatttatcattttagatgatgcgaatctt
gaagaagcggctaaagcggcagtgaagaaagttgttaacaatacagggcaagtatgtaca
gcaggcacacgtacattagtgccggaaagtattaaagacgattttcttaaagaagtaaaa
aaacaaatggcgaacgtgaaagtcggcgatccacaaaatactgaaacacaaatgggtcct
attgtgagtgaaaaacaatacaatcaagtacaagactacattcaaaaaggcatcgatgaa
ggcgctgaactattatacgggggtacaggtaaaccggatggtctagataaagggtatttc
gcgaaacctacaatctttacaaatgtgaataatcaaatgacaatcgcgcaagaagaaatt
tttggacctgttatgtcaattattacgtataaagatttagacgaagcgattgaaattgct
aacgatacaaaatacggacttgccggctatgttttcggtcaaaacaaagaaaaccttatc
cgtgttgcacgttctattgaagcaggtactatcgaaattaacgaagctggacgtgcgtca
gacttaccattcggtggttataaacaatcaggtattggccgtgaatggggcgacttcggt
attgaagaatttttagaagtgaaatctattgcaggttattacaaaggtgaataa

DBGET integrated database retrieval system