KEGG   Candidatus Profftella armatura: SSDC_00410Help
Entry
SSDC_00410        CDS       T02777                                 

Gene name
sdhA
Definition
(GenBank) succinate dehydrogenase flavoprotein subunit
  KO
K00239  succinate dehydrogenase / fumarate reductase, flavoprotein subunit [EC:1.3.5.1 1.3.5.4]
Organism
ssdc  Candidatus Profftella armatura
Pathway
ssdc00020  Citrate cycle (TCA cycle)
ssdc00190  Oxidative phosphorylation
ssdc00650  Butanoate metabolism
ssdc01100  Metabolic pathways
ssdc01110  Biosynthesis of secondary metabolites
ssdc01120  Microbial metabolism in diverse environments
ssdc01130  Biosynthesis of antibiotics
ssdc01200  Carbon metabolism
Module
ssdc_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ssdc_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ssdc_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ssdc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    SSDC_00410 (sdhA)
   00650 Butanoate metabolism
    SSDC_00410 (sdhA)
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    SSDC_00410 (sdhA)
Enzymes [BR:ssdc01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.5  With a quinone or related compound as acceptor
    1.3.5.1  succinate dehydrogenase
     SSDC_00410 (sdhA)
    1.3.5.4  fumarate reductase (quinol)
     SSDC_00410 (sdhA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: FAD_binding_2 Succ_DH_flav_C Pyr_redox_2 GIDA Thi4 DAO FAD_binding_3 HI0933_like FAD_oxidored Pyr_redox_3
Motif
Other DBs
NCBI-ProteinID: AGS06776
UniProt: S5RLH0
LinkDB All DBs
Position
73900..75675
Genome map
AA seq 591 aa AA seqDB search
MIFNKSIIANYRFDVLIIGAGGSGMRASLQLAQEGLNVAILSKVFPTRSHTVAAQGGISA
SLGNMSKDNWHWHMFDTIKGSDYLGDQDAIEFMCKEAPKVVYELEHFGMPFDRNKNGTIY
QRPFGGHSSNFGEKPIARACAVADRTGHALLHTLYQRNLHAKTNFFIEWMAIDLISDSEG
DILGVVALEMETGNIMILESKITILATGGGGRIWAASTNAFINTGDGLGMAARAGLPLED
MEFWQFHPTGVAGAGVLITEGVRGEGGILINSNGERFMERYAPILKDLAPRDFVSRAMDQ
EIKEGRGCGPNKDHVMLDLRHINSETIINRLPSILEIGNKFANVNALKEPIPVIPTIHYQ
MGGIPTNIYGQVIIPNNDNNKIVNGLYAIGECACVSVHGANRLGTNSLLDLLVFGRSAGN
HILSLELKKIHNKKLPINSIDIIIDRLSKLENNKGSESVQSVANDIRKTMQNYCGVFRTD
KLMKNGYKKIMILDERRKYISFKDKSKIFNTARIEALELDNLIETAKATISSAISRKESR
GAHAHNDFKNRDDINWLKHSIWYSNGNRIEFKPVNLKPLTVKTVHPKKRTF
NT seq 1776 nt NT seq  +upstreamnt  +downstreamnt
gtgatttttaataaatctattattgctaattatcgtttcgatgtattaattattggagca
ggtgggtcaggtatgcgggcttcacttcagttagcgcaagagggtttaaatgttgcaatt
ttatctaaagtttttcctactcgttcgcatacagttgctgctcaaggagggattagtgct
tcgttgggtaatatgtcaaaagataattggcattggcatatgtttgatactattaaagga
tctgattatctcggagatcaagacgctattgaatttatgtgcaaagaagcgccaaaagtt
gtgtatgaattagaacattttgggatgccatttgatcgaaataaaaatggtacaatttat
cagaggccatttggtgggcattcatctaattttggagaaaaacctatagctcgcgcttgt
gctgtagctgatcgtaccggtcatgcgcttttgcatacactatatcaacgtaatttacat
gctaaaactaatttttttatcgaatggatggctattgatttaattagtgattccgagggt
gatattttaggagttgttgcgttagaaatggaaactggcaatataatgatattggaatct
aaaataacaattttagccacaggaggaggagggcgtatttgggctgcttctactaatgct
tttataaatactggtgatggacttggtatggcagcgcgagcgggtttacctttagaagat
atggaattttggcaatttcatccgactggagttgcgggtgctggagttttaattacagag
ggcgttcgaggtgaaggtggaattttaattaattctaatggtgaacgttttatggagcgt
tatgccccgattttaaaagatctcgctcctcgtgattttgtatctcgagcaatggatcaa
gaaattaaagaaggacgtggttgcggaccaaataaagaccatgtaatgttagatttgaga
cacattaattctgaaacaattataaatcgtttaccatcgattttagagattggaaataaa
tttgcaaatgtaaatgcattaaaagaacctattccagttataccaactattcattatcaa
atgggcggtattccaacgaatatttatggacaagttataatacctaataatgataataat
aaaattgttaatggtttatatgcaattggtgaatgtgcttgcgtatccgtacatggagct
aatagacttggaactaattcattattagatttattggtatttggtcgttctgctggtaat
catattcttagtttagaacttaaaaaaattcataataaaaaacttcctattaattctatt
gatattattattgaccgattatcaaaattagaaaataataaaggatctgaaagtgttcag
agtgtagctaatgatattcgtaaaactatgcaaaattattgcggcgtatttcgaacagat
aaattaatgaaaaatggttataaaaaaattatgattttagacgaacgacgtaaatatatt
tcttttaaagataaatctaaaattttcaatactgcaagaattgaagcgctagaattagat
aatttaattgaaacagctaaagcaactatttcttccgctatttctcgtaaagaatctaga
ggcgctcacgcgcataatgactttaaaaatcgagatgatattaattggttaaaacattca
atttggtattcaaatggaaatagaattgaatttaaaccagttaatttaaaaccattaaca
gttaaaactgttcatcctaaaaaacgtactttttaa

DBGET integrated database retrieval system