KEGG   Shewanella sediminis: Ssed_0830Help
Entry
Ssed_0830         CDS       T00596                                 

Definition
(GenBank) FAD-dependent pyridine nucleotide-disulphide oxidoreductase
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
sse  Shewanella sediminis
Brite
KEGG Orthology (KO) [BR:sse00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Ssed_0830
Enzymes [BR:sse01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Ssed_0830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox FAD_binding_2 GIDA Thioredoxin_3 HI0933_like FAD_oxidored NAD_binding_7 DAO AlaDh_PNT_C Thi4 FAD_binding_3 NAD_binding_8 FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: ABV35441
UniProt: A8FRG8
LinkDB All DBs
Position
984810..986378
Genome map
AA seq 522 aa AA seqDB search
MLDANLKNQLNTYLQNLKRPVELVVSADDSPKAQELRLLARDIESLSPLVSISEAQGKRM
PSMKVTNAESMTDITFAGLPMGHEFTSLVLALLHTGGHPLKLDDAIIAQIKALSGEYHFE
TYVSLSCQNCPDVVQALNMMAAINPNITNVMIDGSLFQTEVFERDILAVPSVYLNGELFA
QGRISLTEILNKIDTGAVARQAEALAEKEPFEVLVVGGGPAGASAAIYAARKGLRTGIVA
DKFGGQVAETVGIENFISVKATEGPKLVANLEAHVHEYDVDIMDNQRALSLKSGELFELE
LENGAVLRSKTVLLATGARWREMNVPGEQEYRGKGVAYCPHCDGPLFKGKRVAVIGGGNS
GIEAAIDLANIVEHVTVLEFDTKLRADEVLQRKAASMGNIEIITQAMTTEVNGDGKRVNG
LNYTDRATGESHHVALAGIFVQIGLIPNSEWLKDTIDLTVRGEIIVDGKGETSVPGIFAA
GDVTNSAFKQIIIAMGSGATASLGAFDYLIRHSEPEQEQVAA
NT seq 1569 nt NT seq  +upstreamnt  +downstreamnt
atgttagatgcgaatcttaaaaatcaactgaacacctatctgcaaaacctcaagcgccca
gttgaacttgtcgtgtctgcagatgacagccctaaagcccaagagctcagattattagcc
cgggacattgagagtctgtcaccattagttagcatttctgaagcccaaggcaagcgtatg
ccatcgatgaaagtgactaatgcagagagcatgacagatattacgtttgccggcctgcct
atggggcacgagtttacctctcttgttttagctctgcttcataccggtggtcacccatta
aagctggatgatgcgattattgcgcagataaaggcattgtcgggcgaataccattttgaa
acctatgtttctctgagttgccagaactgcccggatgttgtgcaggcactcaatatgatg
gcggcgatcaatccgaatatcaccaacgtgatgatcgacggttctctgtttcaaacagag
gtctttgagcgagatatcttagccgtaccttctgtttatcttaatggtgaactcttcgct
caagggcgtatcagcttaactgaaattttaaataaaattgataccggagccgtagcccgt
caggcagaggctctggcggaaaaagagcctttcgaagtcttagtcgttggtggtggcccg
gctggagcatcggctgctatctacgcggcacgtaaagggttgcgcaccgggatcgtggcc
gacaaatttggtggccaggttgccgaaactgtgggtattgaaaactttatctcagttaag
gccaccgaaggccctaagctggtggcaaatctcgaggcccatgttcatgaatatgatgtc
gatatcatggataaccaaagagcgctaagccttaagtccggtgaactgttcgaactggag
ctggagaatggcgcggtgctcaggagtaagactgtacttctggcgacgggcgcaagatgg
cgtgaaatgaatgtacctggtgagcaggagtatcgtggtaaaggtgtggcttactgcccg
cattgtgatggcccgctgtttaaaggtaaacgtgtcgccgttattggtggtggtaattca
ggcatagaagcggcaatcgatctggctaatatcgtcgagcatgtcaccgtgctggagttc
gacactaagttaagagccgatgaggtcttgcagcgtaaagcggcttcaatgggtaatatt
gagatcatcactcaggcgatgacaaccgaggtcaatggtgatggtaagcgtgtcaacggt
ctcaattatacagacagagcaacgggtgaatctcatcatgtagcgcttgccggtatcttc
gttcaaattggcttgataccgaactctgaatggttaaaggacactatcgatctgaccgtc
agaggcgagatcatcgtcgatggtaaaggtgaaacatccgtgcctggtatctttgccgcc
ggtgatgtaactaactcggctttcaagcagattattattgccatgggcagtggcgcaact
gcctctctcggtgcttttgattaccttatcaggcatagcgaacccgagcaggaacaggtt
gccgcctaa

DBGET integrated database retrieval system