KEGG   Shewanella sediminis: Ssed_2291Help
Entry
Ssed_2291         CDS       T00596                                 

Definition
(GenBank) Serine-type D-Ala-D-Ala carboxypeptidase
  KO
K07259  serine-type D-Ala-D-Ala carboxypeptidase/endopeptidase (penicillin-binding protein 4) [EC:3.4.16.4 3.4.21.-]
Organism
sse  Shewanella sediminis
Pathway
sse00550  Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:sse00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ssed_2291
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:sse01002]
    Ssed_2291
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sse01011]
    Ssed_2291
Enzymes [BR:sse01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Ssed_2291
   3.4.21  Serine endopeptidases
    3.4.21.-  
     Ssed_2291
Peptidases and inhibitors [BR:sse01002]
 Serine peptidases
  Family S13: D-Ala-D-Ala peptidase C family
   Ssed_2291
Peptidoglycan biosynthesis and degradation proteins [BR:sse01011]
 Peptidoglycan biosynthesis and degradation
  DD-Carboxypeptidase/DD-Endopeptidase (Low molecular weight PBP)
   Ssed_2291
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_S13 Peptidase_S11 Beta-lactamase2
Motif
Other DBs
NCBI-ProteinID: ABV36900
UniProt: A8FVM7
LinkDB All DBs
Position
2774783..2776240
Genome map
AA seq 485 aa AA seqDB search
MKKLTSALLLYWLSTSTACADEYFSNILSLIKPPHSHTSVIATDLVNDSVIYEENADILL
LPASTQKLLTAVAATAALGNQFNYKTEIYSHFPIRNGKIMGDVFIKFSGDPTLTSLELRE
LFKQLTDQGLLQIEGDLYLVGEKHEELQAPGWVWDDLGICFAAPVSSFIINKNCVHGQLK
PTLASSASQIQFPSYLPVIIDNSAIFDKNSTLEFCNLSLQRLTNNHFNLTGCHSGNRPLK
LAIAITEPALFARDTVAQIAKSSQIKVTGKILLKDTLPQHRSLIASHQSKALPEMLNTML
VKSDNLIADSLLKQIGHKQYNRPGTFTNGSKAMVQILTEEGVDLTHARIVDGSGLSRYNL
LSARQLSQVLRLIYTDPRFMSLMESLPVAGISGTLKYKPSFTSAPLRKYVWAKTGSMQGV
DNLAGFIKKPKTDDMLFVILENGQSPIEKEQQLAPFSALFLQTLLDHTAAPTELNATTAK
SVIAN
NT seq 1458 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagttaacttctgccctactcctatattggctttccacttcgacagcctgcgct
gatgagtatttcagtaatatattgtctctgattaagcctcctcactctcacacctctgtt
atagcaactgatctggtcaatgactccgtcatttacgaggaaaatgccgatattttactt
ctgcctgccagtactcaaaagttgctcaccgcagttgccgcaactgcagctcttggaaat
cagtttaattataagactgaaatttattctcattttccgatccgaaacggtaagattatg
ggtgatgtttttattaaatttagtggcgatccgacactgactagtcttgagctaagagaa
ctgtttaaacaactaacggatcagggcctgcttcaaatagagggggatctctatctcgtc
ggcgagaaacatgaagagttacaagcacccggttgggtatgggatgacttagggatctgt
tttgccgctcccgtatccagttttattatcaataaaaactgtgtacatgggcaactaaaa
ccaacacttgctagtagtgccagtcaaatccaattccccagctatcttccggtgattatc
gataatagtgccatttttgataaaaacagtacccttgaattttgtaatttgagtctacag
cgtctaaccaataatcactttaatctaacgggctgtcactccggaaatcgtcccttaaaa
ctcgccatagccataactgaaccagccttgtttgcaagagataccgtggctcagattgcg
aagagtagtcaaatcaaggtaacaggtaagatattactcaaagacaccttgccacaacat
cgcagccttattgccagccatcagtcaaaagcgctgcctgagatgctcaataccatgtta
gtcaaatctgataacctcatcgcggatagcttattgaagcagataggacacaagcagtat
aaccgtcccggcacctttactaatggcagcaaggcgatggttcagattttgactgaagaa
ggtgtcgatctgacccacgccagaattgtggatggttcggggctatcgcgttataacttg
cttagtgccagacagctcagtcaggtattgaggttaatctatacagatccgagatttatg
agtctcatggaatcactacctgtcgcaggtatcagtggcaccctcaaatacaaaccatca
tttaccagcgccccacttcgaaaatatgtttgggcaaagacagggtctatgcagggcgtt
gataacttggctggttttatcaagaagcccaagacagacgatatgctgtttgtcatttta
gaaaatggacagagcccgatagagaaggagcagcaacttgcaccattcagtgcccttttc
ttgcagaccttactggaccacaccgcagcgcccacagagctcaatgcgacgacggccaag
tcagtaatagcgaattaa

DBGET integrated database retrieval system