KEGG   Shewanella sediminis: Ssed_3485Help
Entry
Ssed_3485         CDS       T00596                                 

Definition
(GenBank) Peptidoglycan glycosyltransferase
  KO
K05515  penicillin-binding protein 2 [EC:3.4.16.4]
Organism
sse  Shewanella sediminis
Pathway
sse00550  Peptidoglycan biosynthesis
sse01501  beta-Lactam resistance
Brite
KEGG Orthology (KO) [BR:sse00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Ssed_3485
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01501 beta-Lactam resistance
    Ssed_3485
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:sse01011]
    Ssed_3485
Enzymes [BR:sse01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.16  Serine-type carboxypeptidases
    3.4.16.4  serine-type D-Ala-D-Ala carboxypeptidase
     Ssed_3485
Peptidoglycan biosynthesis and degradation proteins [BR:sse01011]
 Peptidoglycan biosynthesis and degradation
  DD-Transpeptidase (Class B PBP)
   Ssed_3485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Transpeptidase PBP_dimer
Motif
Other DBs
NCBI-ProteinID: ABV38089
UniProt: A8FZ16
LinkDB All DBs
Position
4242522..4244378
Genome map
AA seq 618 aa AA seqDB search
MAPKKRITMHDHAAEASLFKRRALFTFACVVILLGILLTNLYHLQILSYTDYETRSNDNR
IRVVPVAPSRGLIFDRHGKLLAENQPFFSLELIPEKVKDVPAVLAELSTLIPLSADEQED
FQKSLKYHRRFKPLTLKNRLSESEVALFSVNRHRFPGISVVAGLKRHYPYNGMMTHALGY
VGRINDRDRAALQRNDLWKNYAATKYIGKQGIEKFYENLLHGQPGHLEEEVNNRGRTIRT
LKSVPPVPGQDIYLTLDLQLQEKAVELLNGRRGSVVAIDPRDGGILAMVSSPTYDPNLFV
HGISTKAYNELLNSRSRPLINRATQGQYAPASTVKPHIALLGLEDKTITEKTRVWDPGFW
QIPGVERKYRDWKRWGHGWVDVNSALVGSCDTYFYELAYKTGVDKIANFMQPFGFGERTG
VDIFEESAGIMPSKDWKRMRYNQPWYIGDTISVGIGQGYWTTTPLQLANAAAIMANKGKR
FVPHLLKSIKDSTAKINSPVDEMAPIELKDPKNWEIINNAMRDTAHKKRFKDATYTAAMK
TGTAQVINVAADAKYDADNIDEHLRDNALVIAYAPFENPKVVLAVVLENAGWGGANAGPV
ARALLDEYMLRDSWESIQ
NT seq 1857 nt NT seq  +upstreamnt  +downstreamnt
gtggcgccaaagaagcggataactatgcatgaccacgcagcggaggcatcgcttttcaaa
cgaagagcattgtttacattcgcttgcgtcgtcattttgttgggaatattactgacaaac
ctctatcacctgcaaatactctcttataccgactacgaaactcgttctaatgataaccgt
atcagagttgtacctgtcgcgccgagtcgaggcctgatattcgaccgccatggcaagctc
ttagctgaaaatcagcctttcttttccttagaactcatccctgagaaagtaaaagatgtc
cccgcagtactggctgaattaagtacgcttatcccactgtctgccgatgagcaggaagat
ttccaaaagtcactgaaatatcacagacgttttaagccgttaacgctaaagaaccgcctg
agcgaaagtgaagtcgcactgttcagcgtcaatcgtcatcgatttccaggtatatctgtg
gttgccggactaaaacgtcactacccttacaacggaatgatgacccatgcattaggttat
gtaggaagaattaacgaccgagatcgagcagcattacaacgtaatgacctatggaaaaat
tacgcagcaaccaaatacataggtaagcaaggtatcgagaagttctatgaaaatctgctt
catggtcagccaggtcatttagaggaagaggtcaataatcgaggccgcacaattcgaact
ctaaaatcagttccgccggtaccgggtcaggatatctacctgactctagacttacagcta
caagaaaaagccgttgaattgttaaatggacgcaggggctctgtcgtcgctatcgaccct
cgtgatggcggaatattggctatggtgtcgagtcctacctatgacccgaatctttttgta
cacgggatcagtaccaaggcatacaatgagctactcaactctcgctcccgccctctgatt
aaccgagcgacccaaggacagtatgcaccagcttcgacagttaagccccatatcgcatta
ctcgggttggaagataaaacaatcacagaaaagacccgagtctgggaccccggcttctgg
cagatccccggcgtcgagagaaagtacagagactggaaacgctggggacatggttgggta
gatgtaaatagcgccttagtcggctcttgcgatacctacttttatgagcttgcctataaa
acaggtgtagataagattgctaacttcatgcaaccctttggttttggtgagcgaaccggc
gtcgacatttttgaagagtcggcgggcatcatgccatcgaaagattggaagcgcatgagg
tacaaccaaccttggtatatcggagataccatctctgtaggtatcggtcagggctactgg
accacaacaccattacaactcgccaacgctgcagcgattatggcgaacaaaggcaaacgc
tttgtgccacatctgttgaaatcaataaaagacagcacggcaaaaattaactctcccgtc
gatgagatggcaccgattgagcttaaagaccctaaaaactgggagatcatcaataatgcg
atgagagatacggctcataagaaacgattcaaagatgcgacctatactgccgcgatgaaa
accggtacggctcaagttatcaatgtggccgcagatgcaaaatatgatgcagataatatc
gatgaacacttgcgagataacgcattagtcattgcctatgccccctttgaaaatcccaag
gttgtattggccgtggtacttgaaaatgcgggctggggtggcgctaatgcggggccagtt
gccagagctctgctggatgaatatatgttacgagatagctgggagtcgattcaatga

DBGET integrated database retrieval system