Streptomyces seoulensis: D0Z67_08555 Help Entry D0Z67_08555       CDS       T07029                                  Name (GenBank) acyl carrier protein   KO K02078   acyl carrier protein Organism sseo  Streptomyces seoulensis Pathway sseo00998   Biosynthesis of various antibiotics sseo01100   Metabolic pathways sseo01110   Biosynthesis of secondary metabolites Brite KEGG Orthology (KO) [BR:sseo00001]  09100 Metabolism   09103 Lipid metabolism    00061 Fatty acid biosynthesis     D0Z67_08555   09110 Biosynthesis of other secondary metabolites    00998 Biosynthesis of various antibiotics     D0Z67_08555 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  PP-binding PP-binding_2 DUF1493 Motif Other DBs NCBI-ProteinID:  QBJ90357 UniProt:  A0A4P6TU65 LinkDB All DBs Position 1816550..1816798 Genome browser AA seq 82 aa AA seqDB search MAATQEEIVAGLAEIVNEIAGIPTEDVQLDKSFTDDLDVDSLSMVEVVVAAEERFDVKIP DEDVKNLKTVGDATDYILKHQA NT seq 249 nt NT seq  +upstreamnt  +downstreamnt atggccgccacccaggaagagatcgtcgcgggccttgccgagatcgtgaacgagatcgcc ggcatccccaccgaggacgtccagctcgacaagtccttcacggacgacctcgacgtcgac tccctgtccatggtcgaggtcgtcgtcgccgccgaggagcgcttcgacgtgaagatcccc gacgaggacgtcaagaacctgaagaccgtcggtgacgccaccgactacatcctcaagcac caggcctga

DBGET integrated database retrieval system