KEGG   Streptococcus suis A7 (serotype 2): SSUA7_0783Help
Entry
SSUA7_0783        CDS       T02020                                 

Definition
(GenBank) thymidine kinase
  KO
K00857  thymidine kinase [EC:2.7.1.21]
Organism
ssf  Streptococcus suis A7 (serotype 2)
Pathway
ssf00240  Pyrimidine metabolism
ssf01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssf00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    SSUA7_0783
Enzymes [BR:ssf01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.21  thymidine kinase
     SSUA7_0783
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TK KdpD AAA_30 AAA_22 ATPase_2
Motif
Other DBs
NCBI-ProteinID: AER44110
LinkDB All DBs
Position
823269..823850
Genome map
AA seq 193 aa AA seqDB search
MAQLYYKYGTMNSGKTIEILKVAHNYEEQGKPVVIMTSALDTRDAFGVVSSRIGMRREAV
AIDDDMDIFGFIEKMEPRPYCVLIDEAQFLRRHHVYALARVVDELDVPVMAFGLKNDFRN
ELFEGSQHLLLLADKLDEIKTICQYCSKKATMVLRTQDGKPTYEGEQIQIGGNETYIPVC
RKHYFSPEIKDLP
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
gtggctcaattatattataaatatgggacgatgaattctggcaaaaccattgaaattctt
aaagtagcccataactatgaagagcaaggcaagcccgttgtcatcatgacctctgccttg
gatactcgtgatgcctttggcgttgtttcaagccgtattggtatgcgacgtgaagcggta
gcgattgacgatgatatggatatctttggttttatcgaaaaaatggaaccgcgtccttac
tgtgttctcattgatgaagcacaatttcttcgacgtcatcatgtctacgcacttgctcgc
gtagtcgatgaattagatgtacccgttatggctttcggtcttaaaaatgatttccgaaat
gaactatttgaaggttcccaacatttgctcttattggctgataaattagatgaaatcaaa
acaatctgccaatattgttctaaaaaagccaccatggttttgcgaacacaagacggtaaa
cctacctatgaaggagaacaaatccaaattggtggcaatgaaacctacattcctgtctgt
cgcaaacattatttttcaccggaaattaaagatttaccctaa

DBGET integrated database retrieval system