KEGG   Streptococcus suis A7 (serotype 2): SSUA7_1659Help
Entry
SSUA7_1659        CDS       T02020                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ssf  Streptococcus suis A7 (serotype 2)
Pathway
ssf00010  Glycolysis / Gluconeogenesis
ssf00020  Citrate cycle (TCA cycle)
ssf00620  Pyruvate metabolism
ssf01100  Metabolic pathways
ssf01110  Biosynthesis of secondary metabolites
ssf01120  Microbial metabolism in diverse environments
ssf01130  Biosynthesis of antibiotics
ssf01200  Carbon metabolism
Module
ssf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ssf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUA7_1659
   00020 Citrate cycle (TCA cycle)
    SSUA7_1659
   00620 Pyruvate metabolism
    SSUA7_1659
Enzymes [BR:ssf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SSUA7_1659
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2 HlyD_3
Motif
Other DBs
NCBI-ProteinID: AER44977
LinkDB All DBs
Position
complement(1680180..1681568)
Genome map
AA seq 462 aa AA seqDB search
MAIEIIMPKLGVDMQEGEIIEWKKQEGDFVNEGDVILEMMSDKTSMELEAEESGVLLKIV
HGNGATVPVTEVIAYIGAEGETVEAGASSAPAVEPAAAIEEVPAGRTPVIVAPATAAKPQ
GSGKVRATPAARKLARELGIDLGLVPGTGANGRVHKVDVEDFKGAAPKATPLAARIAADQ
GVDLSTLTGSGVNGKIVKNDVLAVLAPVAVETAAPVPKAEEKPAKELPEGVEIIKMSPMR
KAISKGMVNSYLTAPTFTLNYDIDMTNLMALRKQVLEPIMNKTGLKVTFTDLIGLAVVRT
LMKEEHRYMNASLINDAQEIELHKFVNLGIAVGLDDGLVVPVVHGADKMSLSDFVVASKD
VIKKAQSGKLKGAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVASTVQTPVVIDGE
IKIRPIMALCLTIDHRIIDGMNGAKFMVDLKNLLENPLELLI
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atggctattgaaatcattatgcctaagctcggtgtggacatgcaagaaggtgaaatcatc
gagtggaaaaaacaagagggcgattttgtcaacgaaggcgacgtcatcttggaaatgatg
tctgacaagaccagcatggagctggaagcagaagagtcaggcgtcctattgaaaattgtt
cacggaaacggtgctaccgttcctgtaacagaagttattgcctacatcggtgctgaaggt
gaaacggttgaagccggcgcttcatctgctcctgctgttgaaccagcagcggctattgaa
gaagtacctgcgggtcgtacaccagtaatcgttgctcctgcaactgctgccaaaccacaa
ggtagtggcaaggtgcgtgcaacgccagctgcgcgtaaattggcgcgtgagcttggaatc
gacttgggtcttgttccaggaacaggtgctaacggtcgtgtccacaaggttgacgtcgaa
gacttcaagggagcagctccaaaagcaactccgcttgcagcccgtattgcagcagaccaa
ggtgttgacttgtcaacccttacaggttcaggtgtcaacggtaagattgtcaagaacgac
gttcttgcagtacttgctcctgtagctgtagaaactgctgctccagtaccaaaagcagaa
gaaaaaccagctaaagaattgccagaaggcgttgaaatcatcaagatgagcccaatgcgt
aaggcgatttcaaaaggtatggtcaactcttacttgactgctccgacatttacacttaac
tacgatattgacatgaccaacctcatggcacttcgtaagcaagtccttgagccaatcatg
aacaagactggtttgaaagtaacctttacagacttgatcggtcttgcggttgttcgtact
ttgatgaaagaagaacaccgttacatgaacgcatctttgattaacgatgcacaagaaatc
gaattacacaagttcgtcaaccttggtatcgcagtgggtctagatgatggcttggtggtt
ccagttgttcacggcgcagataagatgagcttgtctgactttgtggtggcttcgaaagat
gtcatcaagaaggctcaatctggtaagttgaagggggctgaaatgtcaggttcgaccttc
tctatcaccaacttgggtatgtttggtactaaaacctttaacccaatcatcaaccaacca
aactcagcaatccttggtgtagcatcaactgttcaaacaccagttgttattgacggcgaa
atcaagatccgtccaatcatggcactctgcttaaccatcgaccaccgtatcattgatggt
atgaatggtgctaagttcatggttgacttgaagaacttgctggaaaacccattggaattg
ttgatctga

DBGET integrated database retrieval system