KEGG   Streptococcus suis A7 (serotype 2): SSUA7_1659
Entry
SSUA7_1659        CDS       T02020                                 

Definition
(GenBank) branched-chain alpha-keto acid dehydrogenase subunit E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ssf  Streptococcus suis A7 (serotype 2)
Pathway
ssf00010  Glycolysis / Gluconeogenesis
ssf00020  Citrate cycle (TCA cycle)
ssf00620  Pyruvate metabolism
ssf01100  Metabolic pathways
ssf01110  Biosynthesis of secondary metabolites
ssf01120  Microbial metabolism in diverse environments
ssf01200  Carbon metabolism
Module
ssf_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ssf00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SSUA7_1659
   00020 Citrate cycle (TCA cycle)
    SSUA7_1659
   00620 Pyruvate metabolism
    SSUA7_1659
Enzymes [BR:ssf01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SSUA7_1659
SSDB
Motif
Pfam: 2-oxoacid_dh E3_binding Biotin_lipoyl Biotin_lipoyl_2
Other DBs
NCBI-ProteinID: AER44977
LinkDB
Position
complement(1680180..1681568)
AA seq 462 aa
MAIEIIMPKLGVDMQEGEIIEWKKQEGDFVNEGDVILEMMSDKTSMELEAEESGVLLKIV
HGNGATVPVTEVIAYIGAEGETVEAGASSAPAVEPAAAIEEVPAGRTPVIVAPATAAKPQ
GSGKVRATPAARKLARELGIDLGLVPGTGANGRVHKVDVEDFKGAAPKATPLAARIAADQ
GVDLSTLTGSGVNGKIVKNDVLAVLAPVAVETAAPVPKAEEKPAKELPEGVEIIKMSPMR
KAISKGMVNSYLTAPTFTLNYDIDMTNLMALRKQVLEPIMNKTGLKVTFTDLIGLAVVRT
LMKEEHRYMNASLINDAQEIELHKFVNLGIAVGLDDGLVVPVVHGADKMSLSDFVVASKD
VIKKAQSGKLKGAEMSGSTFSITNLGMFGTKTFNPIINQPNSAILGVASTVQTPVVIDGE
IKIRPIMALCLTIDHRIIDGMNGAKFMVDLKNLLENPLELLI
NT seq 1389 nt   +upstreamnt  +downstreamnt
atggctattgaaatcattatgcctaagctcggtgtggacatgcaagaaggtgaaatcatc
gagtggaaaaaacaagagggcgattttgtcaacgaaggcgacgtcatcttggaaatgatg
tctgacaagaccagcatggagctggaagcagaagagtcaggcgtcctattgaaaattgtt
cacggaaacggtgctaccgttcctgtaacagaagttattgcctacatcggtgctgaaggt
gaaacggttgaagccggcgcttcatctgctcctgctgttgaaccagcagcggctattgaa
gaagtacctgcgggtcgtacaccagtaatcgttgctcctgcaactgctgccaaaccacaa
ggtagtggcaaggtgcgtgcaacgccagctgcgcgtaaattggcgcgtgagcttggaatc
gacttgggtcttgttccaggaacaggtgctaacggtcgtgtccacaaggttgacgtcgaa
gacttcaagggagcagctccaaaagcaactccgcttgcagcccgtattgcagcagaccaa
ggtgttgacttgtcaacccttacaggttcaggtgtcaacggtaagattgtcaagaacgac
gttcttgcagtacttgctcctgtagctgtagaaactgctgctccagtaccaaaagcagaa
gaaaaaccagctaaagaattgccagaaggcgttgaaatcatcaagatgagcccaatgcgt
aaggcgatttcaaaaggtatggtcaactcttacttgactgctccgacatttacacttaac
tacgatattgacatgaccaacctcatggcacttcgtaagcaagtccttgagccaatcatg
aacaagactggtttgaaagtaacctttacagacttgatcggtcttgcggttgttcgtact
ttgatgaaagaagaacaccgttacatgaacgcatctttgattaacgatgcacaagaaatc
gaattacacaagttcgtcaaccttggtatcgcagtgggtctagatgatggcttggtggtt
ccagttgttcacggcgcagataagatgagcttgtctgactttgtggtggcttcgaaagat
gtcatcaagaaggctcaatctggtaagttgaagggggctgaaatgtcaggttcgaccttc
tctatcaccaacttgggtatgtttggtactaaaacctttaacccaatcatcaaccaacca
aactcagcaatccttggtgtagcatcaactgttcaaacaccagttgttattgacggcgaa
atcaagatccgtccaatcatggcactctgcttaaccatcgaccaccgtatcattgatggt
atgaatggtgctaagttcatggttgacttgaagaacttgctggaaaacccattggaattg
ttgatctga

DBGET integrated database retrieval system