KEGG   Selenomonas sputigena: Selsp_0040Help
Entry
Selsp_0040        CDS       T01474                                 

Definition
(GenBank) O-antigen polymerase
Organism
ssg  Selenomonas sputigena
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Wzy_C
Motif
Other DBs
NCBI-ProteinID: AEB99023
UniProt: F4EWP7
LinkDB All DBs
Position
36814..38205
Genome map
AA seq 463 aa AA seqDB search
MKGSFKLIHRYLIAIAIVLLPVFNSLGTDKLGALGRSASTYPLLLGVIVWLGTLVLQRGK
VYYPRNLGFFFLLMFLLTAVLSGLFNLPDLYVLKYQGISGIDRFFIQIFALLFYVFIVIY
IYNAFYHAGKEAERLFVTALSLSFFLAGGYSLFEIGAFLNVPFSTEILGYIDTLFRANEE
LYGLRLRSLANEASMFAMYCTLIFPWIFSRFFRNRRSFGDIIIVSYFILLMGLTFSRTAY
IVFIIQLIVFFILYRKEIFSVGMHGAVYFFAIIGILTFGAISIYFSNMELFEKIDVTALV
YSLVSDDVDNPHLLSNIARYSSQIAAIRMFFDHPVLGVGLGGFGFYAPQYYPDSLGESWE
IIAQSSNTIGGAWPVAHGLYVRILAEMGILGLVFWLFLWGWNIFKSFASLRNLAREQIQY
KKNLLISLIGMLLIGFVGDSLTWASYWIYLGFLGIEESNGCRE
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgaagggttctttcaaacttatacatcgatatttaattgcgattgctatagtcttgctg
ccggtatttaattcattgggaactgataaattgggcgccttggggcgttcggcaagtaca
tatcctttgcttctaggggtgattgtatggttaggaacacttgtgcttcaaagaggaaag
gtgtattatcctcgaaatcttggtttcttttttttgttgatgtttcttttgaccgctgtt
ctttctggattgttcaatcttcctgatttatatgttttgaaatatcaagggatttcgggt
atagatcggttttttattcaaatttttgcgttgctgttttatgtttttatcgttatatat
atatataatgctttttatcatgcgggaaaagaagcagagcgactattcgtaacggcactt
tccctatccttttttttggctggaggatactctctttttgaaataggcgctttcctaaat
gttccgttttcaacagagattttgggttatatagatacactttttcgagctaatgaagaa
ttatacgggttacgtcttcgttccttggcaaatgaagcgtctatgtttgctatgtattgc
acgctgatttttccttggatcttttcgcgtttttttcgtaacaggagaagttttggggat
attatcatcgtttcatactttattcttctaatgggcttgaccttttctaggacggcatat
atagtttttatcatccaattgatagttttctttatactatatagaaaggaaattttttcg
gttggtatgcatggagcggtttatttttttgctataatagggatactgacttttggtgct
atttctatctatttctcaaatatggaactgtttgagaaaatagatgttaccgctctggta
tattcacttgtaagtgatgatgtggataatcctcacttgctatccaatattgcacgctat
tcttctcaaattgcagcgatacgaatgttctttgatcatcctgttttaggtgttggcctt
ggtggatttggattttatgctccgcaatattatcctgattctttaggagagagttgggag
attattgcacagagttctaacacaattggtggtgcatggcctgtggcacatggactatat
gtaaggatattagcagagatgggtattctgggacttgtcttttggttgttcttgtgggga
tggaatatttttaagtcatttgcaagtctaagaaatttggccagggaacaaattcagtat
aaaaagaatttgttgattagtttgattggcatgctgttgattggttttgttggtgatagt
ttgacatgggctagctattggatatatttaggctttttaggaattgaagaatctaatggt
tgtagggaatag

DBGET integrated database retrieval system