KEGG   Selenomonas sputigena: Selsp_0338Help
Entry
Selsp_0338        CDS       T01474                                 

Definition
(GenBank) phosphoenolpyruvate phosphomutase
  KO
K01841  phosphoenolpyruvate phosphomutase [EC:5.4.2.9]
Organism
ssg  Selenomonas sputigena
Pathway
ssg00440  Phosphonate and phosphinate metabolism
ssg01100  Metabolic pathways
ssg01120  Microbial metabolism in diverse environments
ssg01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:ssg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00440 Phosphonate and phosphinate metabolism
    Selsp_0338
Enzymes [BR:ssg01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.9  phosphoenolpyruvate mutase
     Selsp_0338
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PEP_mutase CTP_transf_like
Motif
Other DBs
NCBI-ProteinID: AEB99311
UniProt: C9LY05
LinkDB All DBs
Position
370128..371429
Genome map
AA seq 433 aa AA seqDB search
MKEKIAYACFCTDAIHEGHRNILREAKKRGTVVAGVLSDREMVRYNRFPAVSLEERIALL
EAEPEVERVIVQDAIMYDEVIASLKPDFVVHGDNWRGGPMSAIRENVLANLKKMGGELIE
VPYTWNPDVKKIDERMKERLVMPEFRRRRLRRLLEIVPIVKTIEVHDGLTGLLAEKTVVE
HEGGLDQFDALWISSLCDSTAKGKPDIELVDMSSRIRTIDDVMDVTTKPIILDADTGGLI
EHFVYHVHTLERMGVSAVILEDKIGLKKNSLFGTEVEQQQDTIEHFAAKIRAGKEAQRTD
DFMIIARIESLILEKGLPDALERASAYVAAGADGVMIHSRRKEPDEVFAFADAFQKEYAH
VPLVAVPTSYSSVTEAELAAHGVNIVIYANQLTRSAFPAMERTAMSILKHHRSLEADADL
MPFKDIIRLIDEV
NT seq 1302 nt NT seq  +upstreamnt  +downstreamnt
atgaaagaaaagattgcttacgcgtgcttctgcaccgatgcgattcacgaggggcatagg
aatatcctgcgcgaagccaagaagcgcggaacggtcgtcgcgggagtcctctccgatcgc
gaaatggttcgttacaaccgcttccccgccgtatcgctcgaagagcgcatcgcacttctg
gaagcagagccggaggtcgagcgcgtcatcgtgcaggacgccatcatgtacgatgaggtc
atcgcatcgctgaagcccgatttcgtcgtgcacggcgacaactggcgcggcggtccgatg
tctgcgatccgcgaaaacgtgctggcgaatctcaagaagatgggcggcgagctcatcgag
gtgccctacacatggaatccggatgtcaagaagatcgacgagcgcatgaaggagagactc
gtcatgcccgagttccgccgccgccgtctgcgccgcttgttggaaatcgtgcccatcgtt
aagacgatcgaggtgcacgacgggctcacgggcctcttggcggagaagaccgtcgtcgag
catgagggcggcctcgatcagtttgatgcgctgtggatttcgagcctttgcgactcgacg
gcgaagggaaagcccgacatcgagcttgttgacatgtcctcgcgcatccgcacgatcgac
gatgtcatggacgtgacgacgaagcccatcatcctcgatgccgatacgggcggcctcatc
gagcatttcgtctatcacgtccacacgttggagcgcatgggcgtttctgctgtcatactg
gaagacaagatcggactcaagaagaattcgctcttcggcacggaggtcgagcagcagcag
gatacgatcgagcacttcgcggcgaagatccgggcgggcaaggaggcgcagcgcacggat
gatttcatgatcatcgcacgcatcgagagtctgattctcgaaaagggtctcccggatgcc
ttggagcgtgcctccgcttacgtggcggcgggcgcggatggcgtcatgatccactcgcgc
agaaaggagccggacgaggtattcgccttcgccgatgcttttcagaaggaatacgcgcat
gtgccgctcgttgccgtgccgacctcctacagctctgtgacggaggcggaacttgccgcg
catggcgtgaatatcgtcatctacgcgaaccagctgacgcgcagcgccttccccgcgatg
gagcgcacggcgatgtccatcttgaagcaccatcgttcgcttgaggcggacgcggatctc
atgccgttcaaggacatcattcgcctgatcgatgaagtttga

DBGET integrated database retrieval system