KEGG   Selenomonas sputigena: Selsp_1224Help
Entry
Selsp_1224        CDS       T01474                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
ssg  Selenomonas sputigena
Pathway
ssg00970  Aminoacyl-tRNA biosynthesis
ssg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssg00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Selsp_1224
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:ssg03029]
    Selsp_1224
Enzymes [BR:ssg01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Selsp_1224
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Selsp_1224
Mitochondrial biogenesis [BR:ssg03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Selsp_1224
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: AEC00183
UniProt: C9LTJ7
LinkDB All DBs
Position
complement(1382936..1384375)
Genome map
AA seq 479 aa AA seqDB search
MNYEAVIGLEIHSELKTNTKIFCGCATKFGAEQNTHVCPVCLGLPGVLPVLNKRVVEFAI
KAGLALNCTINKYSKFDRKNYYYPDLPKNFQTSQYDLPIAEHGYVDIETENGTKRIRILR
IHMEEDAGKLVHSGATITDSLTSNVDYNRTGVPLIEIVSEPDMSTPAEARAYMEKIKSIL
EYIDVSNCRMEEGNLRADLNISLRPAGEKTLGTKAEMKNINSFKAVEDALSYEIERQEEI
LEDGGHIVQETRTWDPERGVTKSMRSKEEAHDYRYMPEPDLVPIVTTEEEIEAYRKGLPE
LPDARRERYMKEFGLSAYDAGIITASRAMAEYFEACLAGGADAKSAANWIMGDLAKNLNA
EGKTIEESPVEASRLAQMLALIEKGTISSKIAKKVFAEMWTSSDAPEKIVEDKGLVQITD
TKAIEAIVDAVIAANPKPVADYKSGNKKALGALVGQVMKQSKGKANPQMVNQLLADKLS
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgaattacgaagcagtcatcggtcttgagattcacagcgagctcaagacgaacacgaag
attttctgcggctgcgccacgaagttcggcgccgagcagaatacgcatgtctgccccgtt
tgcctggggctgcccggcgtcctgcccgtgctcaacaagcgcgttgtcgagtttgccatc
aaagcgggtcttgcgctcaactgcacgatcaacaagtacagcaaattcgaccgaaagaac
tactactatcccgatctgccgaagaacttccagacttcgcagtacgatctgccgattgcc
gagcacggttacgtcgatattgagacggaaaatggcacgaagcgcatccgcatcctgcgc
atccacatggaagaggatgcgggcaagctcgtccattcaggcgcgacgatcacggactct
ctgacatcgaacgtcgattacaaccgcacgggcgtgccgctcatcgagatcgtttccgag
ccagacatgtcgacgcccgccgaagcgcgcgcctacatggagaagatcaagtcgatcctc
gaatacatcgacgtttccaactgccgcatggaagagggaaatctgcgcgccgacctcaat
atctcgcttcgtcccgcgggggagaagacgcttggcacgaaggcggagatgaaaaatatc
aactccttcaaggcggttgaggacgctctttcctacgagattgagcgccaggaggaaatc
ctcgaagacggcggtcatatcgtgcaggaaacgcgcacatgggatcccgagcgcggcgtc
acgaagtccatgcgctcgaaggaagaggcgcatgattaccgctacatgccggaaccggat
ctcgtgcccatcgtgaccacggaagaggaaatcgaggcgtaccgcaagggtctgcccgag
ctgcccgatgcacgccgcgaacgctacatgaaggagttcggcctgtcggcttacgatgcg
ggcatcatcacggcgtcgcgggcgatggcggaatacttcgaagcctgcctggcgggcggc
gccgacgcgaagagcgcggcgaactggatcatgggcgaccttgcaaagaacctcaatgcc
gagggcaagacgattgaggaatcgccggtcgaagcctcacgcctcgcgcagatgctcgcg
ctcattgaaaagggcacgatctcgtcgaagattgccaagaaggtttttgccgagatgtgg
acgtcgagcgacgcgcccgagaagatcgtcgaggacaagggactcgtgcagatcacggac
acgaaggcgatcgaggcgatcgtcgatgccgtcatcgccgccaatccgaagcctgtcgcc
gactacaagagcggcaacaagaaggcgctcggcgctctcgtcggccaggtcatgaagcag
tcgaagggcaaggcgaatccgcagatggtcaaccagctgctcgcggacaagctgagctga

DBGET integrated database retrieval system