KEGG   Selenomonas sputigena: Selsp_1887Help
Entry
Selsp_1887        CDS       T01474                                 

Definition
(GenBank) Hexokinase
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
ssg  Selenomonas sputigena
Pathway
ssg00010  Glycolysis / Gluconeogenesis
ssg00051  Fructose and mannose metabolism
ssg00052  Galactose metabolism
ssg00500  Starch and sucrose metabolism
ssg00520  Amino sugar and nucleotide sugar metabolism
ssg00521  Streptomycin biosynthesis
ssg01100  Metabolic pathways
ssg01110  Biosynthesis of secondary metabolites
ssg01120  Microbial metabolism in diverse environments
ssg01130  Biosynthesis of antibiotics
ssg01200  Carbon metabolism
Module
ssg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:ssg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Selsp_1887
   00051 Fructose and mannose metabolism
    Selsp_1887
   00052 Galactose metabolism
    Selsp_1887
   00500 Starch and sucrose metabolism
    Selsp_1887
   00520 Amino sugar and nucleotide sugar metabolism
    Selsp_1887
  09110 Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Selsp_1887
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Selsp_1887
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ssg04131]
    Selsp_1887
Enzymes [BR:ssg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     Selsp_1887
Membrane trafficking [BR:ssg04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    Selsp_1887
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Hexokinase_1 Hexokinase_2 FGGY_C
Motif
Other DBs
NCBI-ProteinID: AEC00841
UniProt: C9LRQ2
LinkDB All DBs
Position
2082682..2083968
Genome map
AA seq 428 aa AA seqDB search
MTMDKKKYDEVLAAFSISDDELQKISADFEAEMQAGLEGEDSTLRMLRSYVALPTGKEIG
DFLALDFGGTNVRALHILLHGGGRYQVIKKAAKPLTEPGVYDYVSESATAEEMFDFLAEL
IDEAIESNRSTTYLLGHTFSFPSVQTDLYNAKLITWTKEFATQGVEGRVVNDLLKEALAR
RGARNVIPVAVINDTVATLLAAAYKKPNAYIGSIYATGQNTCYFEEFTDGSETPTVINME
SGGFGKLRPTKYDRHIDETSEKPGAQHLEKMVSGRYLGEIYGEALADILGKAAPFSFTSI
DLSTIVADAYLDRHEAAAILEEKTGEKFNALELNLLQDLAGVIIARSARLVAATFAGIVR
HRAHGAEIKEQHIAIDGSVYEKMPLVAENLKKALADLLGDEAEKIHIVLENTGSALGAAL
AAAMTVEG
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgaccatggacaagaagaaatacgacgaggtgctcgccgccttcagcatcagtgacgac
gagcttcagaagatttccgccgacttcgaggcggaaatgcaggcgggacttgagggcgaa
gattccacgctgcgcatgctgcgctcctacgtcgccctgccgacaggcaaggaaatcggc
gatttcctcgcgctcgatttcggcggcacaaacgtacgcgccctgcacatcctcctgcac
ggaggcggcagataccaagtcatcaagaaggcggcgaagcccctgaccgagccgggcgtc
tacgactacgtatcggaaagcgccaccgccgaggagatgtttgacttcctcgccgaactc
atcgacgaggccatcgagagcaatcgctcgacgacgtacctgctcggtcacaccttctcc
ttcccgtcggtgcagactgacctctacaacgccaagctcatcacttggacgaaggagttc
gcgacgcagggcgtcgagggcagggtcgtcaacgaccttctgaaagaagcgctcgcacgg
cgcggcgcacgaaacgtcatccccgtcgccgtcatcaacgacaccgtcgccacgctcctt
gccgccgcctacaagaagccgaatgcctacatcggctcgatctacgccacggggcagaac
acctgctacttcgaggagttcacggatggttccgaaacgcccaccgtcatcaacatggaa
tcgggcggcttcggcaagctgcgcccgacaaagtatgacaggcacatcgacgaaacctcc
gaaaagcccggcgcacagcacctcgaaaagatggtctcaggacgctacctcggcgaaatc
tacggcgaggcgctcgccgacatcctcggcaaggccgctcctttctccttcacgagcatc
gacctttccaccatcgtcgccgacgcctacctcgaccgtcacgaagccgctgccatcctc
gaagaaaagacgggcgaaaagttcaacgcgcttgagctgaacctgctgcaagatctcgcg
ggcgtcatcatcgcgcgctccgcccgtctcgtcgccgcgaccttcgcaggcatcgtgcgc
catcgcgcacatggcgcggagatcaaggaacagcacatcgccatcgacggctccgtctac
gagaagatgcccctcgtcgccgaaaacctcaagaaggcgctcgccgacctcctcggcgac
gaagcagaaaagatccacatcgtccttgaaaacaccggctccgccctcggtgcagccctc
gccgccgccatgacggtggaagggtga

DBGET integrated database retrieval system