KEGG   Selenomonas sputigena: Selsp_2056Help
Entry
Selsp_2056        CDS       T01474                                 

Definition
(GenBank) alkyl hydroperoxide reductase F subunit
  KO
K00384  thioredoxin reductase (NADPH) [EC:1.8.1.9]
Organism
ssg  Selenomonas sputigena
Pathway
ssg00450  Selenocompound metabolism
Brite
KEGG Orthology (KO) [BR:ssg00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Selsp_2056
Enzymes [BR:ssg01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.9  thioredoxin-disulfide reductase
     Selsp_2056
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox DAO FAD_binding_2 Thioredoxin_3 NAD_binding_8 FAD_binding_3 NAD_binding_7 HI0933_like FAD_oxidored Thi4 NAD_binding_9 Trp_halogenase GIDA Thioredoxin_9 K_oxygenase NSP10 MCRA Lycopene_cycl
Motif
Other DBs
NCBI-ProteinID: AEC01003
UniProt: C9LYL9
LinkDB All DBs
Position
complement(2285294..2286958)
Genome map
AA seq 554 aa AA seqDB search
MAAEKNELYDAVVIGGGPAGLTAALYLARACCRVLVVEKETFGGQIALTAEVVNYPGSDP
TSGADLTAKMHRQAEGFGAEFLLAEVNSLEKKGDTWHVHTSRGDYETFTVLLATGAHPRQ
IGFAGEKEFRGHGVAYCATCDGEFFTGKDVFVIGGGFAAAEESVFLTKYAKHVTILVREE
DFTCAPATAQPARDNEKISIHFQSEVESVEGDALPRKLTWKNLATGERTVFTPEGGDSFG
VFVFAGYQPSTDLVKGLAELDEHGYIVTDRQQRTTVEGLYAAGDVCIKPLRQVVTATGDG
ALAATEMEKYAMKMEEKTGRKTNHKVCRAAQHTAKDTGKDTGKGAATASTSGPFTADMKK
QLMTVFDRMERPLHLEVALSDDPRSSELLDFMTQLAEMTDKLSVEITGGMGVPNVRIYNA
DGSWAGLAFHGVPGGHEFTSFVLGLYNASSAGQKVADEDLARIEKIKEDHHITIMVSLSC
TMCPELVTSAQRIATLNPHVKTDVYDLSLFPEIKEQYNIMSVPCFFIDDDAKFHFGKKNI
SQLLDLLEQEEANA
NT seq 1665 nt NT seq  +upstreamnt  +downstreamnt
atggcggcggaaaaaaacgagctttatgatgcagtagtgatcggcggcggccctgcgggg
ctgaccgccgcgctttacttggcaagagcctgctgccgtgtgctcgtggtggagaaggag
acttttggcggtcagatcgctctgacggcggaggtcgtgaactatccgggcagcgaccct
acgagcggcgctgacctcacggcgaagatgcaccgtcaggcggaaggcttcggcgcggag
ttcctgctcgccgaagtcaattcgctcgaaaagaagggcgatacttggcatgtgcatacg
agccgcggcgactatgaaacttttaccgtgctgctcgcgacgggcgcacatccgcgccag
atcggctttgcgggcgagaaggaatttcgcgggcacggcgtcgcctactgcgcgacgtgc
gacggcgagttcttcacgggcaaggatgtcttcgtcatcggcggcggcttcgcagcggcg
gaggagagcgtcttcctcacgaagtatgcgaagcatgtgacgatcctcgtgcgcgaggag
gatttcacatgtgctcccgccacggcgcagcccgcacgcgacaatgagaaaatttcgatt
cacttccagtcggaggtcgagtcggtcgagggagacgccctgccgcgcaagctcacatgg
aagaacctcgcgacgggcgagcgaacggtgtttacacccgaaggcggagattccttcggg
gtgttcgtgttcgcgggctaccagccgtcgaccgatctcgtcaagggactggcggagctt
gacgagcatggctacatcgtgaccgaccgccagcagcggacgacggtcgaagggctctat
gcggcgggcgacgtctgcatcaagccgctcaggcaggtcgtgacggcgacgggcgacggt
gctctcgccgcgaccgagatggaaaagtacgccatgaagatggaagaaaagacggggcgg
aagacgaaccacaaggtgtgccgcgccgcgcagcacacggcgaaggatacggggaaggac
acggggaagggagcggcgacggcctcgacgagcggccccttcacggccgatatgaagaag
cagctcatgacggtctttgatcgcatggagcgtcctctgcaccttgaggtcgcgctgagt
gacgatccgcgctccagcgagcttctcgacttcatgacgcagctcgcagagatgacggac
aagctgtccgtcgagatcacaggcggcatgggcgtgccgaacgtgcgcatctacaatgcg
gacggcagctgggcgggactcgccttccacggcgtcccgggcgggcacgagttcacgagc
ttcgtgctcggtctctacaacgcttcgagcgccggacagaaggtcgccgacgaggatctc
gcgcgcattgagaaaatcaaggaagatcaccatatcaccatcatggtaagcctctcgtgc
acgatgtgccctgagctcgtcacgagcgctcagcgcatcgcgacgctcaacccgcatgtc
aagacggatgtctacgacttgagcctcttccccgagatcaaggagcagtacaacatcatg
agcgtgccgtgcttcttcatcgacgacgacgcgaaattccacttcggcaagaagaacatc
tcacagctcctcgacctgctcgaacaggaagaagcgaacgcatga

DBGET integrated database retrieval system