KEGG   Streptococcus suis P1/7 (serotype 2): SSU0319Help
Entry
SSU0319           CDS       T00936                                 

Definition
(GenBank) putative aminotransferase
  KO
K14260  alanine-synthesizing transaminase [EC:2.6.1.66 2.6.1.2]
Organism
ssi  Streptococcus suis P1/7 (serotype 2)
Pathway
ssi00220  Arginine biosynthesis
ssi00250  Alanine, aspartate and glutamate metabolism
ssi00290  Valine, leucine and isoleucine biosynthesis
ssi01100  Metabolic pathways
ssi01110  Biosynthesis of secondary metabolites
ssi01130  Biosynthesis of antibiotics
ssi01210  2-Oxocarboxylic acid metabolism
ssi01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ssi00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    SSU0319
   00290 Valine, leucine and isoleucine biosynthesis
    SSU0319
   00220 Arginine biosynthesis
    SSU0319
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ssi01007]
    SSU0319
Enzymes [BR:ssi01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.2  alanine transaminase
     SSU0319
    2.6.1.66  valine---pyruvate transaminase
     SSU0319
Amino acid related enzymes [BR:ssi01007]
 Aminotransferase (transaminase)
  Class I
   SSU0319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 DegT_DnrJ_EryC1 Aminotran_5
Motif
Other DBs
NCBI-ProteinID: CAR44759
LinkDB All DBs
Position
337496..338710
Genome map
AA seq 404 aa AA seqDB search
MKQFNKSTKLDDVAYDIRGPVLEEAMRMRANGEQILRLNTGNPAEFGFTAPDEVIRDLIH
NARKSEGYSNSKGIFSARKAIMQYCQLKKFPNVDIEDIYLGNGVSELIVMSMQGLLDNGD
EVLVPMPDYPLWTAAVSLAGGKAVHYVCDEVAEWYPDLADMESKVTSRTKAIVLINPNNP
TGALYPKEILKGIIDIARRHELIIFSDEIYDRMVFDGAVHIPIATLAPDLFVVTMNGLSK
SHRICGFRVGWMVLSGPKKHVKGYIEGLNMLSNMRLCSNVLAQQVVQTSLGGYQSVDELL
MPGGRLYEQREFITKAINDIPGLSAVKPKAGLYVFPKIDREMYRVEDDEQFVLDFLKQEK
VLLVHGRGFNWKDPDHFRIVYLPRVDELAEIQEKMSRFLRQYRR
NT seq 1215 nt NT seq  +upstreamnt  +downstreamnt
atgaagcaatttaacaagtcaacaaaattggatgatgtagcatatgatattcgtgggcct
gttttggaagaggccatgcgcatgcgtgccaatggagagcagattttacgtttgaatacg
gggaatcctgcagaatttggttttactgctccagatgaagttattcgtgacttgattcat
aacgcccgtaaatcagagggatattcgaacagtaagggaattttttctgcacgtaaggct
atcatgcagtattgtcagctaaagaaatttccaaatgttgacattgaagatatttatctt
ggaaacggcgtgagtgagctgattgttatgtctatgcaaggtttgctagataatggtgat
gaggtgttggtgccaatgccagactatcctctctggactgctgcagttagtttggctggt
ggtaaagctgttcactatgtttgtgatgaagtagctgaatggtatccagatttggcagat
atggagtccaaggtgacttctcgaaccaaggcaattgtccttatcaatccaaataatcca
actggtgctctctatccgaaagaaattttaaaaggaatcattgatattgctcgtagacat
gaattgatcattttctctgatgagatttatgatcgtatggtctttgatggagctgttcat
atccctattgcgacactggctccagatttatttgttgtgacgatgaatggactgtctaaa
tcacatcgtatttgtggtttccgagtaggttggatggtcttatctggtccgaaaaagcat
gtaaaaggttacattgaaggcttgaatatgttgtccaatatgcgtttgtgttcaaacgtt
ttggctcaacaggttgttcaaacttctttgggaggttaccaatcggttgatgagctcttg
atgcctggcggacgcttatatgaacaaagggagttcattaccaaggcgattaatgatatt
ccgggactttctgctgtaaaacctaaggctggtctgtatgtattcccaaaaattgatcgt
gagatgtacagagttgaggatgatgaacaatttgtattggatttcctcaagcaagaaaaa
gtacttttggtccatggtcgaggttttaactggaaggatccagatcatttccgtattgtg
tatttaccacgtgttgatgagttggcagaaattcaagaaaaaatgtcacgattcttgcgg
caatatcgtagataa

DBGET integrated database retrieval system