KEGG   Streptococcus suis P1/7 (serotype 2): SSU1047Help
Entry
SSU1047           CDS       T00936                                 

Definition
(GenBank) LacI family regulatory protein
Organism
ssi  Streptococcus suis P1/7 (serotype 2)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peripla_BP_1 Peripla_BP_4 LacI Peripla_BP_3 HTH_3 HTH_19 LpxD
Motif
Other DBs
NCBI-ProteinID: CAR46188
LinkDB All DBs
Position
complement(1068490..1069491)
Genome map
AA seq 333 aa AA seqDB search
MSEKFTIKDIAELAQTSKTTVSFYLNGKYEKMSKETRERIERVIRETDYKPSVVARSLNS
KNTKLIGVLIGDITNTFSNQIVKGIEEEAHKSGYQVIIGNSNYNQESEDKYIESMLMLGV
DGFIIQPTSHFRKYSRIIEDKKKHMVFFDSQLYEHRTSWIKTNNYDAVYDATQLCVENGY
QKFILITADISRLSTRIERATGFMDALLDCKQSYQDLTIADENTDIEEIKCFLQGVVNPQ
EKTLVFVPNCWALPLVFNAMKELKYDFPQVGLLGFDNTEWTNFSSPTISTIVQPAFEEGC
QATRMLINQIEGGNQVGRQQVLDCTVHWKDSTF
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgtcagagaagtttaccatcaaagatattgcagaactggctcagacttcaaaaacaaca
gtttccttttacttaaatggtaaatatgaaaagatgtccaaagagacacgcgaaagaatt
gagagagtcattcgcgaaacagactataaacccagcgttgttgcgcggagcctaaattca
aaaaatactaagttgattggagtattgattggtgatattacaaatacattttccaatcaa
attgtcaaaggtatagaagaagaagcgcataagagtggctatcaagttatcatcggaaac
agcaattacaatcaagaaagcgaagataagtatattgagagtatgctgatgttgggtgta
gatggttttattattcagccgacatcgcattttagaaaatattcgcgcattattgaggat
aagaaaaagcatatggttttctttgatagtcagctttacgaacaccgtaccagttggatt
aagacaaataattatgatgctgtctatgatgcaactcaactatgtgtagaaaatggttat
caaaaatttattcttattacagctgacattagtcgcttaagtacacggattgaacgagct
acagggtttatggatgctctgttagattgtaaacaaagttatcaagatttaacaattgca
gatgaaaatacggacatagaggaaattaaatgttttcttcaaggggtggtaaatcctcag
gaaaagaccctagtattcgttccgaattgctgggcgttacctttagtttttaatgctatg
aaagaacttaaatatgactttcctcaggttggtcttttggggtttgacaatactgaatgg
acaaatttttcatcccctactatctctaccattgttcaacccgcctttgaagaagggtgt
caggcaacaaggatgctgatcaatcagattgagggcggaaaccaagtgggacgacaacag
gttttagattgcacagttcattggaaagattctacattctaa

DBGET integrated database retrieval system