KEGG   Streptococcus suis P1/7 (serotype 2): SSU1184Help
Entry
SSU1184           CDS       T00936                                 

Gene name
ddlA
Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
ssi  Streptococcus suis P1/7 (serotype 2)
Pathway
ssi00473  D-Alanine metabolism
ssi00550  Peptidoglycan biosynthesis
ssi01100  Metabolic pathways
ssi01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:ssi00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    SSU1184 (ddlA)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    SSU1184 (ddlA)
 09160 Human Diseases
  09168 Drug resistance
   01502 Vancomycin resistance
    SSU1184 (ddlA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:ssi01011]
    SSU1184 (ddlA)
Enzymes [BR:ssi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     SSU1184 (ddlA)
Peptidoglycan biosynthesis and degradation proteins [BR:ssi01011]
 Precursor biosynthesis
  Amino acid ligase
   SSU1184 (ddlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATP-grasp_4
Motif
Other DBs
NCBI-ProteinID: CAR46476
LinkDB All DBs
Position
complement(1205485..1206531)
Genome map
AA seq 348 aa AA seqDB search
MSKETLILLYGGRSAEREVSVLSAESVMRAINYDKFFVKTYFISQTGDFIKTQEFSQTPS
ADEKLMTNATIVEEQKIRPSDIYEEKAVVFPVLHGPMGEDGSIQGFLEVLRMPYVGTNIL
SSSVAMDKITTKRVLESAGISQVPYVAVIEGENIDDKIAEIEGKLTYPVFVKPANMGSSV
GISKAEDLAGLRKALDLAFKYDSRVLVEQGVNAREIEVGLLGNADVKTTLPGEVVKDVAF
YDYDAKYIDNKITMEIPAKIDESIMDIMRDNAAKAFRAIGGCGLSRCDFFLTEDGDIFLN
ELNTMPGFTQWSMYPLLWDNMGLAYPDLIEELVRLAKEMFEKRESHLI
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgtcaaaagaaaccttgattttactatatggtgggcgttctgcagagcgtgaggtatct
gttctgtctgccgaaagcgtcatgcgtgctatcaattatgataaattttttgtcaaaacc
tatttcattagccagaccggggactttattaagacgcaagagttttctcaaacaccgtct
gccgatgaaaaactcatgacaaacgcgacgattgttgaagagcaaaaaatccgtccgagc
gatatttatgaagaaaaggcggttgttttccctgttcttcatggcccaatgggagaagac
ggatctattcaaggcttcttggaagtgcttcgtatgccttatgttggcactaatatcttg
tcttcaagcgttgctatggacaaaatcactaccaagcgcgtacttgaatcagcaggaatc
tcccaggtaccttatgtggcagttatcgagggtgaaaatatcgacgataagattgcagag
attgaaggaaaattgacttatccggtctttgtaaaaccagctaatatggggtcaagtgtc
ggtatctcaaaagctgaggatttagctggcttgcgtaaggcacttgatctggccttcaag
tatgatagccgtgtcctcgttgagcagggtgttaatgcgcgtgagattgaggtcggtctt
ttgggaaatgctgacgtgaaaacgacacttcctggcgaagtagtcaaagacgttgctttt
tatgactacgatgccaaatacatcgacaacaaaatcaccatggaaatcccagctaagatt
gatgagtctatcatggatatcatgcgtgataatgctgccaaggccttccgtgctatcggt
ggttgtggactttctcgctgtgatttcttcctgactgaagacggcgacatcttcctaaac
gaactcaataccatgccaggtttcacccaatggtctatgtatccactcctttgggataat
atgggcctagcttatccagacttgattgaagagcttgttcgtttggctaaggaaatgttt
gaaaaacgcgaaagtcacctcatttaa

DBGET integrated database retrieval system