KEGG   Streptomyces alfalfae: A7J05_00260Help
Entry
A7J05_00260       CDS       T05110                                 

Definition
(GenBank) 4-aminobutyrate aminotransferase
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ssia  Streptomyces alfalfae
Pathway
ssia00250  Alanine, aspartate and glutamate metabolism
ssia00410  beta-Alanine metabolism
ssia00640  Propanoate metabolism
ssia00650  Butanoate metabolism
ssia01100  Metabolic pathways
ssia01120  Microbial metabolism in diverse environments
Module
ssia_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ssia00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    A7J05_00260
   00650 Butanoate metabolism
    A7J05_00260
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A7J05_00260
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A7J05_00260
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ssia01007]
    A7J05_00260
Enzymes [BR:ssia01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     A7J05_00260
Amino acid related enzymes [BR:ssia01007]
 Aminotransferase (transaminase)
  Class III
   A7J05_00260
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: APY84423
UniProt: A0A1P8T9Y5
LinkDB All DBs
Position
52322..53608
Genome map
AA seq 428 aa AA seqDB search
MARLSPVLKPATPVTVSHARGLDVYGDDGRRYLDFTAGIGVTSTGHCHPAVVSAIAGQAE
RLLHGQYVTVRHRPLLDLCDRLGQVLPAELQSLFFANSGSEAVEAALRLARQATGRPNVI
VFHGGFHGRTVGAASMTTSSPRFRTGYAPLMAGVHIAPFPSAYRYGWSEDEATRFALQEL
DFLLATVTAPEDTAALVVEPVLGEGGFVPAPAAFAQGLRERADHHGFCLVMDEVQTGFGR
TGRFWGHQHLGVEPDILVAAKGLTSGLPLSVMAASEKLMSMAPAGSQGGTYGGNAVACAA
ALATLEVIAEEELVANAAAQGLRLAQGLRRIAEDHAVPGDVRGLGLMLGWEFSEPDGRPD
AARALRVQQEAIAAGLLLQIGGPMRNVLRLLPALVVDEAQVDRAVGALSRAVASAAGSTC
ADRTKEHA
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atggcacgcttatcgcccgtactgaaaccagcgactccggtcaccgtcagccatgcccgt
gggctcgacgtgtacggggacgacgggcggcggtatctggacttcaccgccgggatcggg
gtcaccagcaccggccactgccacccggccgtggtcagcgccatcgcaggccaggcggaa
cggctgctccatggtcagtacgtgaccgtacggcaccggcccctgcttgacctgtgcgac
cgtctggggcaggtgcttccggccgaactgcagtccctgttcttcgccaactccggcagc
gaggccgtcgaggcggcgctgcgcctggcccggcaggccacgggacgccccaacgtcatc
gtcttccacgggggcttccacggcaggaccgtgggagccgcgtccatgaccacatcgagc
ccgcgctttcgcaccgggtacgcgccgctgatggccggcgtgcacatcgcgccgttcccc
tccgcgtaccggtacggctggagcgaggacgaggccacccggttcgccctgcaagagctc
gacttcctgctggccaccgtgaccgcccccgaggacaccgcggccctcgtcgtggaaccg
gtgctcggcgagggcgggttcgttcccgcccccgccgccttcgcgcagggcctgcgggag
cgcgccgaccaccacgggttctgcctggtgatggacgaggtccagaccgggttcgggcgt
acggggcgcttctggggccaccagcacctgggcgtcgagcccgacatcctggtggccgcc
aaggggctgaccagcggtctgcccctgtcggtcatggccgcgtcggagaagctgatgagc
atggcccccgcgggctcccagggaggcacctacggcgggaacgcggtggcgtgcgccgcg
gcgctggccacgctcgaggtcatcgcggaggaggaactggtggccaacgccgccgcccag
gggctgcggctggcccaggggctgcggcggatcgccgaggaccacgccgtcccgggtgac
gtccgcgggctcggcctgatgctcggctgggagttctccgagccggacggcaggccggac
gcggcgagggcgctccgcgtccagcaggaggcgatcgccgcgggtctgctgctccagatc
ggcggacccatgagaaacgtactgcggctgcttcccgcgctggtcgtggacgaagcccag
gtcgacagggcagtcggcgcgctgtcccgggccgtcgcctcggccgccgggtccacgtgc
gccgaccggacgaaggagcacgcgtga

DBGET integrated database retrieval system