KEGG   Streptomyces alfalfae: A7J05_03480
Entry
A7J05_03480       CDS       T05110                                 

Definition
(GenBank) 1-epi-valienol-1,7-bisphosphate-1-adenylyltransferase
  KO
K20427  valienol-1-phosphate guanylyltransferase [EC:2.7.7.91]
Organism
ssia  Streptomyces alfalfae
Pathway
ssia00525  Acarbose and validamycin biosynthesis
ssia01100  Metabolic pathways
ssia01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssia00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00525 Acarbose and validamycin biosynthesis
    A7J05_03480
Enzymes [BR:ssia01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.91  valienol-1-phosphate guanylyltransferase
     A7J05_03480
SSDB
Motif
Pfam: NTP_transferase NTP_transf_3
Other DBs
NCBI-ProteinID: APY84934
UniProt: A0A1P8TBD5
LinkDB
Position
923628..924746
AA seq 372 aa
MAEPGAVRAVLLAGGEGRRMGPLGTGRLKPLVPYGGACRLIDFSLANARASGLGEVVLLS
QYEERQLMDDLHRVWNTSPGFRVHFGPYDHAYRTAGAGLPRELPERAWPLERGTADALIR
KSAYVFGGDAEQVLVLHADHVYRFDYGPLIEEHRASGAALTVAYQRIEPRWVHLFGMVEF
DAAGHLTAFVEKPENPTSDLVFAAFCVFDARVLRRHLELLDGTDWQHDISRDVIPAMLAA
GEHIRGHEVAGHWQDIGTVERYHRAHLALASPQPDAPALPVERMPWTVAPEVARHRVARG
PGVRDSVVPADLVNHGLVEDSVLFPGVRVGAGARVRRSVVLPGAAVPSGADLVSAVVMED
GRVQQVADGARP
NT seq 1119 nt   +upstreamnt  +downstreamnt
atggctgagcccggcgcggtacgggcggtgctgctcgcgggcggcgagggcaggcgcatg
ggcccgctcggcaccggccgcctcaagcccctcgtgccctacggcggcgcctgccgcctc
atcgacttcagcctggccaacgcgcgggcgtccgggctcggcgaggtcgtgctgctctcc
cagtacgaggagcggcagctcatggacgacctgcaccgggtgtggaacacctcgcccggc
ttccgggtgcacttcggcccgtacgaccacgcctaccgcacggccggggccggcctgccc
cgtgaactgcccgagcgggcctggcccttggagcgcggcacggccgacgcgctgatccgc
aagagcgcgtacgtcttcgggggcgacgccgagcaggtcctcgtcctccacgccgaccac
gtctaccgcttcgactacgggccgctcatcgaggagcaccgggcgtcgggggccgcgctg
accgtcgcgtaccagcgcatcgaaccgcgctgggtgcacctgttcggcatggtcgagttc
gacgcggcggggcatctgacggcgttcgtcgagaagcccgagaaccccacgagcgacctg
gtcttcgccgcgttctgcgtcttcgacgcgcgcgtgctgcgccgccatctggagctgctg
gacggcacggactggcagcacgacatcagccgcgacgtgatccccgcgatgctcgcggcc
ggagagcacatccgcggccacgaggtcgccgggcactggcaggacatcggcaccgtcgag
cgctaccaccgcgcccacctcgccctcgcctccccgcagcccgacgcgcccgcgctgccc
gtcgagcggatgccctggaccgtcgcgcccgaggtggcgcgccaccgggtggcccgcggc
cccggcgtacgggactccgtggtccccgccgacctggtcaaccacggcctggtggaggac
agcgtgctgttccccggcgtccgtgtcggcgccggggcccgggtgcggcgcagcgtcgtc
ctgcccggcgccgccgtgccgtcgggcgccgacctggtctcggcggtggtcatggaggac
ggccgtgtgcagcaggtggcggacggggcgcggccgtga

DBGET integrated database retrieval system