KEGG   Streptomyces alfalfae: A7J05_06335Help
Entry
A7J05_06335       CDS       T05110                                 

Definition
(GenBank) galactose mutarotase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
ssia  Streptomyces alfalfae
Pathway
ssia00010  Glycolysis / Gluconeogenesis
ssia00052  Galactose metabolism
ssia01100  Metabolic pathways
ssia01110  Biosynthesis of secondary metabolites
ssia01120  Microbial metabolism in diverse environments
ssia01130  Biosynthesis of antibiotics
Module
ssia_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:ssia00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    A7J05_06335
   00052 Galactose metabolism
    A7J05_06335
Enzymes [BR:ssia01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     A7J05_06335
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim TAT_signal
Motif
Other DBs
NCBI-ProteinID: APY85387
UniProt: A0A1P8TCP8
LinkDB All DBs
Position
1637531..1638700
Genome map
AA seq 389 aa AA seqDB search
METSRRTVLAGAAAAGLTAAVTGTSYAAEGGARTAPSSKPVRELFGRLADGTKVYRWSLA
NGGTRLKVLSYGGVVQSLEIPDRHGRHTNVSLGYDSIEEYVAGTTFFGALIGRYGNRVAR
GRFTLDGTTHQLSVNDGENSLHGGAKGFNTRVWDVEPFTDATGVGLVLRHVSVDGEMGYP
GTLRVKVTYTLTARGDWRIDYAATTDKATVVNLTNHTYFNLAGEGSGDIYGHELTLAARQ
FTPTDAGLIPTGELAKVAGTPFDFRRAKTVGRDIRAAHPQLVTAKGYDHNWVLDKGITRA
PEHFATLRDADSGRTMKVATTEPGVQFYSGNFLDGALTGPSGRTYRQGDGLCLETQHFPD
SPNQPSFPSTVLRPGETYRSSTVHVFSAR
NT seq 1170 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgagcagacgcaccgtcctggccggcgccgccgcggcgggtctcaccgccgcc
gtcaccggcacctcgtacgcggcggagggcggcgcgcggaccgcgccctcgtcgaagccg
gtacgggaactcttcggcaggctagccgacggaacgaaggtctaccgctggtcgctggcg
aacggcggcacccggctgaaggtcctctcctacggcggcgtcgtgcagtcgctggagatt
cccgaccgccacggccgccacaccaacgtctccctcggctacgactcgatcgaggagtac
gtcgcgggcaccacgttcttcggcgccctgatcggccgctacggcaaccgcgtggcccgg
ggccgcttcaccctggacggcacaacccaccagctctccgtgaacgacggcgagaacagc
ctgcacggcggcgcgaagggcttcaacacgcgcgtgtgggacgtggagccgttcacggac
gccaccggcgtcggcctcgtcctgcggcacgtgagcgtcgacggcgagatgggctacccg
ggcacgctgcgcgtgaaggtgacgtacaccctcaccgcccgcggtgactggcggatcgac
tacgcggcgacgaccgacaaggccacggtcgtgaacctcaccaaccacacgtacttcaac
ctggcgggcgagggcagcggcgacatctacggtcatgaactcaccctggccgcacgccag
ttcactccgacggacgccggtctgatccccacgggtgagctggcgaaggtggccggcacg
cccttcgacttccggcgggccaagacggtcgggcgggacatccgcgccgcccacccgcag
ctggtgaccgccaaggggtacgaccacaactgggtgctcgacaagggcatcacgcgcgcc
cccgagcacttcgcgacgctgcgggacgcggactccggccgcacgatgaaggtcgccacg
accgagccgggcgtgcagttctactccggcaacttcctcgacggcgccctcaccgggccc
tcgggccgcacctaccggcagggcgacgggctctgcctggagacccagcacttccccgat
tccccgaaccagccgtcgttcccctcgacggtgctgcgccccggtgagacctaccggtcg
agcacggtgcacgtcttctcggcacgctga

DBGET integrated database retrieval system