KEGG   Streptomyces alfalfae: A7J05_06710Help
Entry
A7J05_06710       CDS       T05110                                 

Definition
(GenBank) aminotransferase class III
  KO
K00823  4-aminobutyrate aminotransferase [EC:2.6.1.19]
Organism
ssia  Streptomyces alfalfae
Pathway
ssia00250  Alanine, aspartate and glutamate metabolism
ssia00410  beta-Alanine metabolism
ssia00640  Propanoate metabolism
ssia00650  Butanoate metabolism
ssia01100  Metabolic pathways
ssia01120  Microbial metabolism in diverse environments
Module
ssia_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:ssia00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    A7J05_06710
   00650 Butanoate metabolism
    A7J05_06710
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    A7J05_06710
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    A7J05_06710
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:ssia01007]
    A7J05_06710
Enzymes [BR:ssia01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     A7J05_06710
Amino acid related enzymes [BR:ssia01007]
 Aminotransferase (transaminase)
  Class III
   A7J05_06710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: APY85447
UniProt: A0A1P8TCV5
LinkDB All DBs
Position
complement(1735462..1736745)
Genome map
AA seq 427 aa AA seqDB search
MTDLYDRHKAVLPDWLALYYRRPIEITHGEGRHVWDAEGRKYLDFFGGILTTMTAHALPE
VTKAVAEQAGRIIHSSTLYLNRPMVDLAERVAALSGIPDARVFFTTSGTEANDAALLLAT
AHRRSNQILAMRNSYHGRSFTAVGITGNASWSPTSLSPLQTLYVHGGVRSRGPYAALSDA
EFTAACVADLRDMLGQGRGGVAALIAEPIQGVGGFTSPPDGLYAAFKEVLDEHGILWISD
EVQTGWGRTGEHFWGWQAHAASGPPDILTFAKGIGNGMSIGGVVARAEVMNGLDANSIST
FGGSPVTMAAGLANLTYLLEHDLQGNARRVGGLLIERLRAVCAQAPAVREVRGRGLMIGV
ELVDPGTGGPDPRAAAAVLEAARERGLLLGKGGGHDTSVLRVAPPLSLTVAEAEEGASIL
EEALRSA
NT seq 1284 nt NT seq  +upstreamnt  +downstreamnt
gtgaccgacctgtacgaccgccacaaggcggtcctgcccgactggctcgccctctactac
cggcggcccatcgagatcacccacggcgagggccggcacgtctgggacgccgagggccgc
aagtacctcgacttcttcggcggcatcctcaccaccatgaccgcgcacgccctgcccgag
gtcaccaaggccgtggcggagcaggccggacggatcatccactcctcgacgctctacctc
aaccggccgatggtcgacctcgccgagcgcgtcgccgccctctccggcatccccgacgcc
cgcgtcttcttcaccacctccggcaccgaggccaacgacgcggcgctgctcctggccacc
gcccaccgccgctccaaccagatcctggcgatgcgcaacagctaccacggccgcagcttc
acggccgtcggcatcaccggcaacgcctcctggtcgccgaccagcctctcgcccctccag
acgctgtacgtgcacgggggcgtccgcagccgggggccgtacgccgcgctgagcgacgcg
gagttcaccgcggcctgcgtcgccgacctgcgggacatgctggggcaggggcgcggggga
gtggcggcgctcatcgccgagccgatccagggcgtcggcggcttcacctcgccgcccgac
gggctctacgccgccttcaaggaggtcctggacgagcacggcatcctctggatctccgac
gaggtgcagacgggctggggccgcacgggcgagcacttctggggctggcaggcgcacgcg
gcgagcgggccgccggacatcctgacgttcgccaagggcatcggcaacggcatgtcgatc
ggcggtgtggtggcccgcgccgaggtcatgaacggcctcgacgccaactccatctccacc
ttcggcggctccccggtcaccatggcggccggcctcgccaacctcacgtacctcctggaa
cacgacctccagggcaacgcccggcgcgtcggcgggctcctcatcgagcggctccgggcc
gtctgcgcccaggcgcccgccgtgcgcgaggtccgcgggcgcggcctgatgatcggcgtc
gagctggtcgaccccggcaccggcgggcccgacccccgggcggcggccgccgtgctcgaa
gcggcccgcgagcgcggcctgctgctcggcaagggcggcggccacgacaccagcgtcctg
cgcgtcgccccgcccctctccttgaccgtcgcggaggcggaggagggcgcgtcgatcctg
gaggaggccctgcgcagcgcctag

DBGET integrated database retrieval system