KEGG   Streptomyces alfalfae: A7J05_09255
Entry
A7J05_09255       CDS       T05110                                 
Name
(GenBank) monooxygenase
  KO
K18091  pentalenolactone D synthase [EC:1.14.13.170 1.14.13.171]
Organism
ssia  Streptomyces alfalfae
Pathway
ssia00998  Biosynthesis of various antibiotics
ssia01100  Metabolic pathways
ssia01110  Biosynthesis of secondary metabolites
Module
ssia_M00819  Pentalenolactone biosynthesis, farnesyl-PP => pentalenolactone
Brite
KEGG Orthology (KO) [BR:ssia00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various antibiotics
    A7J05_09255
Enzymes [BR:ssia01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.170  pentalenolactone D synthase
     A7J05_09255
    1.14.13.171  neopentalenolactone D synthase
     A7J05_09255
SSDB
Motif
Pfam: FMO-like NAD_binding_8 Pyr_redox_2 Pyr_redox_3 DAO NAD_binding_9 FAD_binding_2 Shikimate_DH
Other DBs
NCBI-ProteinID: APY90733
UniProt: A0A1P8TSX1
LinkDB
Position
complement(2311973..2313727)
AA seq 584 aa
MREKYRQERDKRGAGRTYQFARGDFSHYARDPYTERREREPLTDEVDVAVVGAGIGGLLT
GANLRKETGLDRIRLIDEAGDVGGTWYWNRFPGVRCDVESYIYMPLLEETGTIPTEKYST
GPEIFAHLQRIAREYDLYRDALFQTTVTELRWDEAAARWLVSTDRGDVIRARYVAMSIGL
MHRPKLPGLPGLDAFAGHSFHASRWDFDYTGGDSTGGLTGLRDKRVGVIGTGSTTIQLAP
HLAEWAKELVLFQRTPATVDVRGNRPTPPGWAESLEPGWQQRRMENFHALTSGIPQDEDL
VQDRWTQTTAKLAAAILPTGDTGGDPKERALAAERADFLKMEELRARIDSVVTDPATAAA
LKPYYRVYCKRPCFHDGYLQTFNRPNVTLVDTQGQGVERLTPAGVVANGREYPVDCLIFA
TGYEHEFAVPYTERAGYDIVGRGGTRLSEKWADGARTLHGLQVNGFPNCFILSKVQAGRH
VNIAYMLGEQTRHLAHIVKCVEERGHRVVEASEAGEKEWVEEILRLASSDLDFLENCTPG
LYNNEGDPGGLPLLNSSYGGGSVEFVNILRRWREAGDLAGLDLR
NT seq 1755 nt   +upstreamnt  +downstreamnt
atacgggagaagtaccggcaggaacgcgacaagcgcggcgccggccgcacctaccagttc
gcgcgcggcgacttcagccactacgcgcgcgacccctacaccgagcggcgggagcgcgaa
ccgctcaccgacgaggtggacgtcgccgtcgtcggcgccggcatcggcggcctgctgacc
ggcgccaacctgcgcaaggagacaggcctcgaccgcatccggctgatcgacgaggccggc
gacgtgggcggcacctggtactggaaccgcttccccggcgtccggtgcgacgtcgagagc
tacatctacatgccgctgctcgaagagaccggcacgatacccaccgagaagtactccaca
ggacccgagatcttcgcccacctccagcggatcgcccgcgagtacgacctctaccgcgac
gccctcttccagaccaccgtcacggagctgcgctgggacgaggccgccgcgaggtggctg
gtgagcaccgaccggggcgatgtgatccgcgcccgctacgtggccatgtcgatcggcctg
atgcaccgccccaaactccccggactgccgggcctcgacgcgttcgccgggcactccttc
cacgccagccgctgggacttcgactacaccggcggcgacagcaccggcggcctgaccggg
ctgagggacaagcgggtcggcgtcatcggcaccggctcgacgaccatccagctcgccccg
cacctcgccgagtgggccaaggaactcgtcctcttccagcgcacccccgccacggtcgac
gtccgcggcaaccggcccaccccgcccggctgggcggagagcctggaaccgggctggcag
cagcgccgcatggagaacttccacgcactgacctccggcatcccgcaggacgaggacctg
gtccaggaccgctggacccagaccacggccaagctcgccgccgcgatcctgcccaccggc
gacaccgggggagacccgaaagagcgggcgctcgcggccgagcgggcggacttcctcaag
atggaggagctgcgggcccgcatcgacagcgtcgtcaccgaccccgcgaccgccgccgcc
ctcaagccgtactaccgcgtgtactgcaagcggccctgcttccacgacggctacctccag
accttcaaccggcccaacgtgaccctcgtcgacacccaggggcagggcgtggaacggctc
acccccgccggggtggtcgccaacggccgcgagtacccggtcgactgcctgatcttcgcc
accggctacgagcacgagttcgccgtcccgtacaccgagcgcgccggctacgacatcgtc
ggccgcggcggcacgcggctgtcggagaagtgggcggacggggcgcgcaccctgcacggg
ctccaggtgaacggcttccccaactgcttcatcctgtccaaggtccaggcggggaggcac
gtcaacatcgcctacatgctgggcgagcagacccggcacctcgcgcacatcgtcaagtgc
gtcgaggagcgcggccaccgggtcgtcgaggcctccgaggccggcgagaaggagtgggtg
gaggagatcctccgcctcgccagcagcgacctggacttcctggagaactgcacgcccggc
ctctacaacaacgagggcgacccgggcggactgccgctgctcaactccagctacggcggc
ggctccgtggagttcgtgaacatcctccgacgctggcgcgaggcgggcgacctcgccgga
ctcgacctgcgctga

DBGET integrated database retrieval system