KEGG   Streptomyces alfalfae: A7J05_09270
Entry
A7J05_09270       CDS       T05110                                 
Name
(GenBank) 1-deoxypentalenic acid 11-beta-hydroxylase
  KO
K18056  1-deoxypentalenic acid 11beta-hydroxylase [EC:1.14.11.35]
Organism
ssia  Streptomyces alfalfae
Pathway
ssia00998  Biosynthesis of various antibiotics
ssia01100  Metabolic pathways
ssia01110  Biosynthesis of secondary metabolites
Module
ssia_M00819  Pentalenolactone biosynthesis, farnesyl-PP => pentalenolactone
Brite
KEGG Orthology (KO) [BR:ssia00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00998 Biosynthesis of various antibiotics
    A7J05_09270
Enzymes [BR:ssia01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.11  With 2-oxoglutarate as one donor, and incorporation of one atom of oxygen into each donor
    1.14.11.35  1-deoxypentalenic acid 11beta-hydroxylase
     A7J05_09270
SSDB
Motif
Pfam: PhyH
Other DBs
NCBI-ProteinID: APY85880
UniProt: A0A1P8TE17
LinkDB
Position
complement(2316232..2317092)
AA seq 286 aa
MTDTFSDYADCTPLIDDREALDRFYDEHGYLYLRGVLDRDLVRTAAEQMLEGLIALGHAA
PGTTLETLTIESFEAVDEVAMHDYVKYDDLWNHPSTLKVWEKAFGEPVFVFKSTTIRYYP
SAAGAAGSEEPHFLTPLHQDGFYIGPNKDFRTAWIPLLPTTPGTGGVALADGSHKKGPRE
HVVTENFRRFGHPVRGIPAEEFGADERLLFSPMEPGDVLLFHAYMCHKSIPNVSADPAAM
RMSMDTRVQPATSHRGFNSLTPWPESAKDASKGILSKITGTPTTIE
NT seq 861 nt   +upstreamnt  +downstreamnt
atgacggacactttcagcgactacgccgactgcacgcccctcatcgacgaccgtgaggcc
ctcgaccggttctacgacgagcacggctacctctatctgcgcggcgtcctcgaccgcgac
ctcgtgcggaccgccgccgagcagatgctcgaaggcctgatcgccctcggccacgccgct
cccggcaccacgctggagaccctcaccatcgaatccttcgaggcggtcgacgaggtggcg
atgcacgactacgtcaagtacgacgacctgtggaaccacccctccaccctcaaggtctgg
gagaaggccttcggcgagcccgtcttcgtcttcaagtcgacgacgatccgctattacccc
tccgccgcgggcgccgcgggctcggaggaaccgcacttcctgacgcccctgcaccaggac
ggcttctacatagggccgaacaaggacttccgcaccgcctggataccgctgctcccgacg
acccccgggacgggcggcgtcgccctcgccgacggcagccacaagaagggcccgcgcgag
cacgtcgtcaccgagaacttccgccgcttcggccaccccgtacgcggtatccccgccgag
gagttcggcgcggacgagcgcctgctgttctcgcccatggaaccgggggacgtgctcctc
ttccacgcctacatgtgccacaagtccatcccgaacgtctccgcggacccggccgccatg
cggatgtcgatggacacccgcgtccagcccgccacctcgcaccgcgggttcaactccctg
acgccctggccggagtccgcgaaggacgcctccaagggaatcctgtcgaagatcaccggt
acgcccaccaccatcgaatga

DBGET integrated database retrieval system