KEGG   Streptomyces alfalfae: A7J05_12170Help
Entry
A7J05_12170       CDS       T05110                                 

Definition
(GenBank) ATP-dependent DNA ligase
Organism
ssia  Streptomyces alfalfae
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_ligase_A_M RNA_ligase PNKP_ligase
Motif
Other DBs
NCBI-ProteinID: APY90792
UniProt: A0A1P8TT36
LinkDB All DBs
Position
3051935..3052804
Genome map
AA seq 289 aa AA seqDB search
MRVALAESVTALPEGDGWAYEPKFDGHRMVILLDEAGQVTLQARSGRDVTAAFPDLERAA
ARLPAGAVLDGEVVVWSGGRIDFAAVQQRAAATPLRAGALARALPASYAAFDLLAEGGDD
CRRLPYAERRARLVRLLAPWGPPLQAVPSTTDRDTALTWYETLPETGVEGLVAKRLDGAY
RSGTRAWLKLRHSDTRDAVVIGCTGPPGRPQALVLALPGDGAPVVSSPLSPEVRAEASRV
LPDPAGEGVATAIGIGEITYAALPEEPAVMAEVRQNTTRHATAVVVRFR
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
gtgcgggtcgccctggcggagagcgtgaccgcgctgccggagggggacggctgggcgtac
gaacccaagttcgacggtcaccgcatggtcatcctcctggacgaggccgggcaggtgacg
ctccaggcccgctccgggcgcgacgtcaccgcggccttcccggacctggagcgcgccgcg
gcccggctgcccgcgggcgccgtcctcgacggcgaggtcgtggtctggtccggcgggcgc
atcgacttcgccgccgtgcagcagcgggcagcggcgaccccgctgcgcgcgggcgccctc
gcgcgcgccctgcccgcgtcgtacgcggcgttcgacctgctcgcggagggcggcgacgac
tgccgccggctgccgtacgcggaacggcgcgcccgcctcgtacggctgctcgcgccctgg
gggccgccgctccaggcggttccgtcgacgaccgaccgggacaccgcgctgacctggtac
gagacgctgccggagaccggtgtcgaggggctggtggcgaagcggctcgacggggcgtac
cggagcggcacgcgcgcgtggctgaagctgcggcacagcgacacccgggacgccgtggtg
atcggctgcacgggacctccggggcgtccccaggcgctcgtcctcgccctgcccggcgac
ggcgccccggtggtgtcgtcgccgctctcccccgaggtgcgcgcggaggcctcccgggtg
ctgccggacccggcgggcgagggggtggcgacggcgatcggcatcggcgagatcacgtac
gcggcactgccggaggagccggcggtcatggccgaggtccggcagaacaccacacggcac
gcgacggcggtcgtggtccgcttccgctga

DBGET integrated database retrieval system