KEGG   Streptomyces alfalfae: A7J05_12375Help
Entry
A7J05_12375       CDS       T05110                                 

Definition
(GenBank) superoxide dismutase, Ni
  KO
K00518  nickel superoxide dismutase [EC:1.15.1.1]
Organism
ssia  Streptomyces alfalfae
Brite
KEGG Orthology (KO) [BR:ssia00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A7J05_12375
Enzymes [BR:ssia01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     A7J05_12375
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sod_Ni
Motif
Other DBs
NCBI-ProteinID: APY86407
UniProt: A0A1P8TFM0
LinkDB All DBs
Position
3097357..3097752
Genome map
AA seq 131 aa AA seqDB search
MLSRLFAPTVKVSAHCDLPCGVYDPAQARIEAESVKAVQEKMAGNDDAHYQARATVIKEQ
RAELAKHHVSVLWSDYFKPPHFEKYPELHQLVNDTLKALSAAKASTDPATGQKALDYIAQ
IDKIFWETKKA
NT seq 396 nt NT seq  +upstreamnt  +downstreamnt
atgctttcccgcctgtttgcccccacggtaaaggtcagcgcgcactgcgacctgccctgc
ggcgtgtacgaccccgcccaggcccggatcgaggccgagtcggtcaaggccgtgcaggag
aagatggccggcaacgacgacgcgcactaccaggcgcgcgccacggtcatcaaggagcag
cgtgccgagctcgccaagcaccacgtgtcggtgctctggagcgactacttcaagcccccg
cacttcgagaagtacccggagctgcaccagctggtcaacgacaccctgaaggccctctcg
gccgccaaggcgtcgacggacccggcgacgggccagaaggcgctggactacatcgcccag
atcgacaagatcttctgggagacgaagaaggcctga

DBGET integrated database retrieval system