KEGG   Streptomyces alfalfae: A7J05_14715Help
Entry
A7J05_14715       CDS       T05110                                 

Definition
(GenBank) glycerol-3-phosphate dehydrogenase
  KO
K00111  glycerol-3-phosphate dehydrogenase [EC:1.1.5.3]
Organism
ssia  Streptomyces alfalfae
Pathway
ssia00564  Glycerophospholipid metabolism
ssia01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ssia00001]
 09100 Metabolism
  09103 Lipid metabolism
   00564 Glycerophospholipid metabolism
    A7J05_14715
Enzymes [BR:ssia01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.3  glycerol-3-phosphate dehydrogenase
     A7J05_14715
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO DAO_C FAD_binding_3 FAD_binding_2 FAD_oxidored Pyr_redox_2 3HCDH_N
Motif
Other DBs
NCBI-ProteinID: APY86812
UniProt: A0A1P8TGL9
LinkDB All DBs
Position
complement(3631127..3632785)
Genome map
AA seq 552 aa AA seqDB search
MADRELDVLVVGAGVVGAGTALDAVTRGLSTGLVEARDWASGTSSRSSKLIHGGLRYLEM
LDFALVREALKERGLLLERLAPHLVKPVPFLYPLRHKGWERLYAGSGVALYDAMSMSRGH
GRGLPVHRHLTRRHALRVAPCLKKDALVGAMQYYDAQMDDARYVATLVRTASAYGAKVAN
RAKVTGFLREGERVVGARVQDVEGGGEYEIRAKQVVNATGVWTDDTQAMVGERGQFHVRA
SKGIHLVVPKDRINSTTGLILRTEKSVLFVIPWGRHWIVGTTDTDWDLDKAHPAASSADI
DYLLEHVNSVLARPLSRDDVQGVYAGLRPLLAGESDATSKLSREHTVAHPAPGLVVIAGG
KYTTYRVMAKDAVDEAVHGLDQRVADCVTEDIPLVGAEGYRALWNARARIAARTGLHVVR
VEHLLNRYGALAEEVLELVTADPALGAPLQAAEDYLRAEVVYAASHEGARHLDDVLTRRT
RISIETFDRGTRSARECAELMAPVLGWDKDQIEREVQHYEKRVEAERESQRQPDDLTADA
ARLGAPDIVPLS
NT seq 1659 nt NT seq  +upstreamnt  +downstreamnt
atggccgaccgggagctggacgtcctggtcgtcggcgcaggcgtggtcggtgccggcacg
gctctggacgcggtgacccggggcctgtccaccggcctcgtcgaggcgagggactgggcg
tcgggcacgtccagcagatcgagcaagctgatccacggcgggctccgctatctggagatg
ctcgacttcgcgctggtgcgcgaggccctgaaggagcgcggactgctcctggagcgcctc
gccccgcacctggtgaagccggtgccgttcctctaccccttgcggcacaagggctgggag
aggttgtacgcgggatcgggcgtcgcgttgtacgacgccatgtcgatgtcgcgcggccac
ggccgcggcctgcccgtgcaccgccacctgacgcgccgccacgccctgcgcgtggccccg
tgcctgaagaaggacgccctggtcggcgcgatgcagtactacgacgcccagatggacgac
gcccgctatgtcgccaccctggtgcgcaccgcttcggcgtacggcgcgaaggtcgccaac
cgcgccaaggtcaccggcttcctgcgcgagggcgagcgcgtggtcggcgcccgggtgcag
gacgtcgagggcggcggggagtacgagatccgcgccaagcaggtggtgaacgccaccggt
gtctggacggacgacacgcaagccatggtcggcgagcggggccagttccacgtcagggcg
tccaagggcatccatttggtcgtgccgaaggaccggatcaactccacgacgggcctcatc
ctgcggaccgagaagagcgtcctcttcgtcatcccgtggggccggcactggatcgtgggc
acgaccgacaccgactgggacctcgacaaggcgcacccggccgcctccagcgccgacatc
gactatctcctggagcacgtgaactccgtgctcgcgcggccgctctcccgcgacgacgtc
cagggggtgtacgcggggctcaggcccctgctcgccggcgagtccgacgccacgagcaag
ctctccagggagcacaccgtcgcccaccccgcgccgggcctcgtggtcatcgcgggcggc
aagtacacgacgtaccgcgtgatggccaaggacgccgtcgacgaggccgtgcacggcctc
gaccagcgcgtcgccgactgcgtcacggaggacatcccgctcgtgggcgccgaggggtac
cgcgcgctgtggaacgcccgggcgaggatcgccgcccggacgggccttcatgtggtgcgc
gtggaacacctgttgaaccggtacggcgcgctggccgaggaagtgctcgaactggtcacc
gccgaccccgccctgggcgcgccgctccaggcggccgaggactatctgcgggccgaggtc
gtctacgccgcgtcgcacgagggcgcccggcacctggacgacgtgctgacgcgccggacg
cgcatctccatcgagacgttcgaccggggcacgcgcagcgcccgggagtgcgccgagctg
atggcgcccgtcctcggctgggacaaggaccagatcgagcgggaggtccagcactacgag
aagcgggtggaggccgagcgggagtcgcagcgccagcccgacgacctgacggcggacgcc
gcgaggctgggggcgccggacatcgtgccgctgagttga

DBGET integrated database retrieval system