KEGG   Streptomyces alfalfae: A7J05_17205Help
Entry
A7J05_17205       CDS       T05110                                 

Definition
(GenBank) kynureninase
  KO
K01556  kynureninase [EC:3.7.1.3]
Organism
ssia  Streptomyces alfalfae
Pathway
ssia00380  Tryptophan metabolism
ssia01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ssia00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00380 Tryptophan metabolism
    A7J05_17205
Enzymes [BR:ssia01000]
 3. Hydrolases
  3.7  Acting on carbon-carbon bonds
   3.7.1  In ketonic substances
    3.7.1.3  kynureninase
     A7J05_17205
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_5 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: APY87237
UniProt: A0A1P8THX7
LinkDB All DBs
Position
complement(4176210..4177469)
Genome map
AA seq 419 aa AA seqDB search
MSEPRNQSPGPTDLPGQADLRSRAGALDAEDPLAEKRKAFVLDDTVYLDGNSLGALPAHV
PARVADVIERQWGELRIRSWDESGWWSAPERIGDRVAPLVGAAPGQIVVGDSTSVNVFKA
LVAAVRMARDTDGGAPDERRDEILVDATTFPTDGYIAQSAARLTGCRVIPLAPAEAPAAL
GPRTAAVLLNHADYRTGRLHDLPGLTAAAHAAGALAVWDLCHTAGALPVGLDEHGVDLAV
GCTYKYLNGGPGSPAYLYVRRELQERFDSPLPGWNSHAEPFGMRPGFEAADGVTRGRVGT
PDILSMLALDAALDVWDGVSVDAVRAKSLALTDFFLRCVEAYVPEGLVESLTPKAHAERG
SQVALRCDGAGDVMKRLIEQGVVGDFRAPDVLRFGFTPLYVSFADAEQAARVLARTLGA
NT seq 1260 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaccgcggaaccagtccccgggcccgaccgatctgcccggccaggccgatctg
cggagccgggccggggccctggacgccgaggacccgctggccgagaagcggaaggcgttc
gtccttgacgacacggtctacctggacggcaactcgctgggcgccctgcccgcgcacgtc
ccggcccgcgtcgccgacgtcatcgagcggcagtggggcgagctgcgcatccgctcctgg
gacgagagcggctggtggagcgcgcccgagcgcatcggcgaccgcgtcgccccgctggtc
ggcgccgcccccggacagatcgtggtcggcgactccaccagcgtgaacgtcttcaaggcg
ctggtcgccgcggtgcgcatggcgcgcgacacggacgggggcgcgccggacgagcggcgc
gacgagatcctcgtcgacgccacgacgttccccaccgacggctacatcgcgcagtcggcg
gcccgcctcaccggctgccgggtgatcccgctcgctccggcggaggcgcccgcggcgctc
ggcccgcgcaccgccgccgtgctgctcaaccacgccgactaccgcaccgggcggctgcac
gacctgcccggcctcacggcggcggcgcacgcggcgggcgccctcgccgtctgggacctg
tgccacacggcgggcgcgctgccggtcggtctcgacgagcacggcgtggacctcgccgtg
ggctgcacctacaagtacctgaacggcggcccgggttcgcccgcgtacctctacgtgcgc
cgggaactccaggaacgcttcgactcgccgctgcccggctggaactcgcacgccgagccc
ttcgggatgcggcccggcttcgaggcggcggacggggtgacgcgcgggcgcgtcggcacc
cccgacatcctgtcgatgctcgccctcgacgcggccctcgacgtctgggacggcgtgtcg
gtcgacgcggtgcgggccaagtcgctggccctgaccgacttcttcctgcggtgcgtcgag
gcgtacgtgcccgaagggctcgtggagtcgctcacgccaaaggcgcacgccgagcgcggc
agtcaggtcgcgctgcgctgcgacggcgccggggacgtcatgaagcgcctgatcgagcag
ggcgtggtcggtgacttccgcgcgccggacgtgctgcgcttcggcttcaccccgctgtac
gtctccttcgccgacgccgagcaggcggcccgggtcctcgcgcggaccctgggggcgtga

DBGET integrated database retrieval system